Close

Magic™ Membrane Protein Human GHRL (Ghrelin and obestatin prepropeptide) expressed in E. coli for Antibody Discovery (CAT#: MP0003Q)

This product is a 12.8 kDa Human GHRL membrane protein expressed in E. coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CCL22
  • Protein Length
  • Partial
  • Protein Class
  • Druggable Genome, Secreted Protein, Transmembrane
  • Molecular Weight
  • 12.8 kDa
  • Sequence
  • MGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDEMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK

Product Description

  • Expression Systems
  • E. coli
  • Tag
  • His
  • Endotoxin
  • < 1 EU/µg
  • Purification
  • Conventional chromatography
  • Purity
  • >90% by SDS - PAGE
  • Buffer
  • 20 mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 0.2M NaCl, 0.1mM PMSF

Target

  • Target Protein
  • CCL22
  • Full Name
  • Ghrelin and obestatin prepropeptide
  • Introduction
  • This gene encodes the ghrelin-obestatin preproprotein that is cleaved to yield two peptides, ghrelin and obestatin. Ghrelin is a powerful appetite stimulant and plays an important role in energy homeostasis. Its secretion is initiated when the stomach is empty, whereupon it binds to the growth hormone secretagogue receptor in the hypothalamus which results in the secretion of growth hormone (somatotropin). Ghrelin is thought to regulate multiple activities, including hunger, reward perception via the mesolimbic pathway, gastric acid secretion, gastrointestinal motility, and pancreatic glucose-stimulated insulin secretion. It was initially proposed that obestatin plays an opposing role to ghrelin by promoting satiety and thus decreasing food intake, but this action is still debated. Recent reports suggest multiple metabolic roles for obestatin, including regulating adipocyte function and glucose metabolism. Alternative splicing results in multiple transcript variants. In addition, antisense transcripts for this gene have been identified and may potentially regulate ghrelin-obestatin preproprotein expression.
  • Alternative Names
  • MTLRP; appetite-regulating hormone; In2c-preproghrelin; ghrelin, growth hormone secretagogue receptor ligand; ghrelin/obestatin; preprohormone; growth hormone-releasing peptide; motilin-related peptide; prepro-appetite regulatory hormone; preproghrelin; Growth hormone secretagogue; Protein M46

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us