Close

Magic™ Membrane Protein Human GLP1R (Glucagon like peptide 1 receptor) (CAT#: MP0015F)

The glucagon-like peptide-1 receptor (GLP-1R) is a class B GPCR that is a major therapeutic target for the treatment of type 2 diabetes. The receptor is activated by the incretin peptide GLP-1 (Glucagon Like Peptide) promoting a broad range of physiological effects including glucose-dependent insulin secretion and biosynthesis, improved insulin sensitivity of peripheral tissues, preservation of β-cell mass and weight loss, all of which are beneficial in the treatment of type 2 diabetes.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GLP1R
  • Protein Length
  • Full Length
  • Protein Class
  • GPCR Class B
  • Molecular Weight
  • 53 kDa
  • TMD
  • 7
  • Sequence
  • MAGAPGPLRLALLLLGMVGRAGPRPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDL
    FCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPW
    RDLSECEESKRGERSSPEEQLLFLYIIYTVGYALSFSALVIASAILLGFRHLHCTRNYIH
    LNLFASFILRALSVFIKDAALKWMYSTAAQQHQWDGLLSYQDSLSCRLVFLLMQYCVAAN
    YYWLLVEGVYLYTLLAFSVLSEQWIFRLYVSIGWGVPLLFVVPWGIVKYLYEDEGCWTRN
    SNMNYWLIIRLPILFAIGVNFLIFVRVICIVVSKLKANLMCKTDIKCRLAKSTLTLIPLL
    GTHEVIFAFVMDEHARGTLRFIKLFTELSFTSFQGLMVAILYCFVNNEVQLEFRKSWERW
    RLEHLHIQRDSSMKPLKCPTSSLSSGATAGSSMYTATCQASCS

Product Description

  • Activity
  • Validated by SPRi
  • Application
  • Screening & display technologies, Structural biology, Antibody development
  • Expression Systems
  • Cell-free expression system in the presence of lipid vesicles
  • Tag
  • Histidine tag fused to the N-terminal end of the protein
  • Protein Format
  • Proteoliposome
  • Purification
  • Sucrose gradient
  • Purity
  • >50% by SDS-Page and Coomassie Blue staining
  • Buffer
  • Tris 50mM, pH 7.5

Target

  • Target Protein
  • GLP1R
  • Full Name
  • Glucagon like peptide 1 receptor
  • Introduction
  • This gene encodes a 7-transmembrane protein that functions as a receptor for glucagon-like peptide 1 (GLP-1) hormone, which stimulates glucose-induced insulin secretion. This receptor, which functions at the cell surface, becomes internalized in response to GLP-1 and GLP-1 analogs, and it plays an important role in the signaling cascades leading to insulin secretion. It also displays neuroprotective effects in animal models. Polymorphisms in this gene are associated with diabetes. The protein is an important drug target for the treatment of type 2 diabetes and stroke. Alternative splicing of this gene results in multiple transcript variants.
  • Alternative Names
  • GLP-1, GLP-1R, GLP-1-R

Customer reviews and Q&As    

Q&As

What is the activation mode of GLP1R?

The binding mode of GLP-1R and ligand is mainly the well-known "two-domain model". The C-terminus of the ligand first binds to the extracellular domain of the GLP-1R, which changes the spatial conformation of the GLP-1R and exposes the binding site of the core domain, and then the N-terminal end of the ligand binds to the core domain of the GLP-1R, which activates the GLP-1R. In general, the main role of the extracellular domain of the GLP-1R is to recognize specific ligands, while the core domain plays an important role in signal specificity transmission.
2022-12-25

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us