Close

Magic™ Membrane Protein Human GNRHR2 (Gonadotropin releasing hormone receptor 2 (pseudogene)) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX2151K)

This product is a Human GNRHR2 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GNRHR2
  • Protein Length
  • Full Length
  • Protein Class
  • GPCR
  • TMD
  • 5
  • Sequence
  • MSAGNGTPWGSAAGEEVWAGSGVEVEGSELPTFSAAAKVRVGVTIVLFVSSAGGNLAVLWSVTRREPSQLRPSPVRRLFIHLAAADLLVTFVVMPLDATWNITVQWLAVDIACRTLMFLKLMATYSAAFLPVVIGLDRQAAVLNPLGSRSGVRKLLGAAWGLSFLLAFPQLFLFHTVH

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • GNRHR2
  • Full Name
  • Gonadotropin releasing hormone receptor 2 (pseudogene)
  • Introduction
  • In non-hominoid primates and non-mammalian vertebrates, the gonadotropin releasing hormone 2 receptor gene (GnRHR2) encodes a seven-transmembrane G-protein coupled receptor. However, in human, the corresponding reading frame contains a premature stop codon, which has been suggested to encode a selenocysteine residue, but there is no solid evidence for selenocysteine incorporation (PMID: 12538601). It appears that the human GnRHR2 transcription occurs but the gene does not likely produce a functional multi-transmembrane protein. A non-transcribed pseudogene of GnRHR2 is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene.
  • Alternative Names
  • GNRHR2; GnRH-II-R; GnRH receptor II 5TM; Type II GnRH receptor; gonadotropin-releasing hormone (type 2) receptor 2, pseudogene; Gonadotropin releasing hormone receptor 2 (pseudogene)

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us