Close

Magic™ Membrane Protein Human GPRC5A (G protein-coupled receptor class C group 5 member A) Expressed in Wheat germ, Full Length (CAT#: MPX0005K)

This product is a 60 kDa Human GPRC5A membrane protein expressed in Wheat germ. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GPRC5A
  • Protein Length
  • Full length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 60 kDa
  • TMD
  • 7
  • Sequence
  • MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVCKVQDSNRRKMLPTQFLFLLGVLGIFGLTFAFIIGLDGSTGPTRFFLFGILFSICFSCLLAHAVSLTKLVRGRKPLSLLVILGLAVGFSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLLLTYVLFLMALTFLMSSFTFCGSFTGWKRHGAHIYLTMLLSIAIWVAWITLLMLPDFDRRWDDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS

Product Description

  • Expression Systems
  • Wheat germ
  • Tag
  • GST tag at N-terminus
  • Protein Format
  • Soluble
  • Endotoxin
  • <0.1 EU/μg by the LAL method

Target

  • Target Protein
  • GPRC5A
  • Full Name
  • G protein-coupled receptor class C group 5 member A
  • Introduction
  • This gene encodes a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The encoded protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. This gene may play a role in embryonic development and epithelial cell differentiation.
  • Alternative Names
  • RAI3; TIG1; RAIG1; GPCR5A; PEIG-1; retinoic acid-induced protein 3; G-protein coupled receptor family C group 5 member A; TPA induced gene 1; orphan G-protein-coupling receptor PEIG-1; phorbol ester induced gene 1; phorbol ester induced protein-1; retinoic acid induced 3; retinoic acid responsive; retinoic acid-induced gene 1 protein; GPRC5A; G protein-coupled receptor class C group 5 member A

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us