Close

Magic™ Membrane Protein Human GYPB (Glycophorin B (MNS blood group)) Full Length (CAT#: MPC3576K) Made to Order

This product is a made-to-order Human GYPB membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GYPB
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • MYGKIIFVLLLSEIVSISALSTTEVAMHTSTSSSVTKSYISSQTNGETGQ
    LVHRFTVPAPVVIILIILCVMAGIIGTILLISYSIRRLIKA

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • Flag-StrepII or based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, SMALPs, VLP)

Target

  • Target Protein
  • GYPB
  • Full Name
  • Glycophorin B (MNS blood group)
  • Introduction
  • Glycophorins A (GYPA) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups. GYPB gene consists of 5 exons and has 97% sequence homology with GYPA from the 5' UTR to the coding sequence encoding the first 45 amino acids. In addition to the M or N and S or s antigens, that commonly occur in all populations, about 40 related variant phenotypes have been identified. These variants include all the variants of the Miltenberger complex and several isoforms of Sta; also, Dantu, Sat, He, Mg, and deletion variants Ena, S-s-U- and Mk. Most of the variants are the result of gene recombinations between GYPA and GYPB. Alternate splicing results in multiple transcript variants.
  • Alternative Names
  • GYPB; SS; GPB; GYP; MNS; GYPA; PAS-3; CD235b; glycophorin-B; GYPB-A fusion; GYPB-A-B fusion; GYPB/GYPA fusion; SS-active sialoglycoprotein; Ss blood group; blood group system MNSs, Mur-like; blood group system MNSs, St(a) type E; blood group system MNSs, St(a) type F; glycophorin A; glycophorin B blood group antigen; glycophorin B, blood group system Ss, S, Mit+; glycophorin B/glycophorin A fusion protein; glycophorin Hop; hybrid glycophorin Kip; sialoglycoprotein delta; Glycophorin B (MNS blood group)

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us