Close

Magic™ Membrane Protein Human HLA-DMA (Major histocompatibility complex, class II, DM alpha) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, Partial (27-233aa) (CAT#: MPX4258K)

This product is a 27.4kDa Human HLA-DMA membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • HLA-DMA
  • Protein Length
  • Partial (27-233aa)
  • Protein Class
  • Immunity
  • Molecular Weight
  • 27.4kDa
  • TMD
  • 1
  • Sequence
  • VPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLC

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • HLA-DMA
  • Full Name
  • Major histocompatibility complex, class II, DM alpha
  • Introduction
  • HLA-DMA belongs to the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DMA) and a beta chain (DMB), both anchored in the membrane. It is located in intracellular vesicles. DM plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa and its gene contains 5 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and the cytoplasmic tail.
  • Alternative Names
  • HLA-DMA; DMA; HLADM; RING6; D6S222E; HLA class II histocompatibility antigen, DM alpha chain; MHC class II antigen DMA; class II histocompatibility antigen, M alpha chain; really interesting new gene 6 protein; Major histocompatibility complex, class II, DM alpha

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us