Close

Magic™ Membrane Protein Human HLA-DPA1 (Major histocompatibility complex, class II, DP alpha 1) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, Partial (29-222aa) (CAT#: MPX4451K)

This product is a 26.3kDa Human HLA-DPA1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • HLA-DPA1
  • Protein Length
  • Partial (29-222aa)
  • Protein Class
  • Immunity
  • Molecular Weight
  • 26.3kDa
  • TMD
  • 1
  • Sequence
  • AGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTE

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • HLA-DPA1
  • Full Name
  • Major histocompatibility complex, class II, DP alpha 1
  • Introduction
  • HLA-DPA1 belongs to the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta (DPB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa and its gene contains 5 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DP molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to 4 different molecules.
  • Alternative Names
  • HLA-DPA1; DPA1; PLT1; HLADP; HLASB; DP(W3); DP(W4); HLA-DPA; HLA-DP1A; HLA-DPB1; HLA class II histocompatibility antigen, DP alpha 1 chain; HLA DPA1; HLA-DPA1*01:03:01:New; HLA-DPA1*02:01:01:NEW; HLA-SB alpha chain; MHC class II DP alpha chain; MHC class II DP3-alpha; MHC class II HLA-DPA1 antigen; MHC class II antigen DP alpha chain; MHC class II protein; Major histocompatibility complex, class II, DP alpha 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us