Close
Close

Magic™ Membrane Protein Human HLA-DQA2 (Major histocompatibility complex, class II, DQ alpha 2) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, Partial (24-214aa) (CAT#: MPX4446K)

Datasheet
This product is a 25.6kDa Human HLA-DQA2 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • HLA-DQA2
  • Protein Length
  • Partial (24-214aa)
  • Protein Class
  • Immunity
  • Molecular Weight
  • 25.6kDa
  • TMD
  • 1
  • Sequence
  • EDIVADHVASYGVNFYQSHGPSGQYTHEFDGDEEFYVDLETKETVWQLPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSKFPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDEPLLKHWEPEIPAPMSE

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • HLA-DQA2
  • Full Name
  • Major histocompatibility complex, class II, DQ alpha 2
  • Introduction
  • This gene belongs to the HLA class II alpha chain family. The encoded protein forms a heterodimer with a class II beta chain. It is located in intracellular vesicles and plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (B lymphocytes, dendritic cells, macrophages) and are used to present antigenic peptides on the cell surface to be recognized by CD4 T-cells.
  • Alternative Names
  • HLA-DQA2; HLA-DCA; HLA-DXA; HLADQA2; DC-alpha; DX-ALPHA; HLA class II histocompatibility antigen, DQ alpha 2 chain; DC-1 alpha chain; DX alpha chain; HLA class II histocompatibility antigen, DQ alpha 1 chain; HLA class II histocompatibility antigen, DQ(6) alpha chain; MHC class II DQA1; MHC class II DQA2; MHC class II antigen; Major histocompatibility complex, class II, DQ alpha 2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us