Close

Magic™ Membrane Protein Human IFNLR1 (Interferon lambda receptor 1) Expressed in NS0 for Antibody Discovery, Partial (21-228aa) (CAT#: MPX0834K)

This product is a 50.2 kDa Human IFNLR1 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IFNLR1
  • Protein Length
  • Partial (21-228aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 50.2 kDa
  • TMD
  • 1
  • Sequence
  • RPRLAPPQNVTLLSQNFSVYLTWLPGLGNP
    QDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRV
    RTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILSANATYQLPPC
    MPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSART
    IYTFSVPKYSKFSKPTCFLLEVPEANWA

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.01 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • IFNLR1
  • Full Name
  • Interferon lambda receptor 1
  • Introduction
  • The protein encoded by this gene belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. Three alternatively spliced transcript variants encoding distinct isoforms have been reported.
  • Alternative Names
  • IFNLR1; IFNLR; LICR2; IL28RA; CRF2/12; IL-28R1; CRF2-12; IFN-lambda receptor 1; IFN-lambda-R1; IL-28 receptor subunit alpha; IL-28R-alpha; IL-28RA; class II cytokine receptor CRF2/12; cytokine receptor class-II member 12; cytokine receptor family 2 member 12; interleukin 28 alpha receptor; interleukin 28 receptor A; interleukin 28 receptor, alpha (interferon, lambda receptor); interleukin or cytokine receptor 2; interleukin-28 receptor subunit alpha; likely interleukin or cytokine receptor 2; Interferon lambda receptor 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us