Close
Close

Magic™ Membrane Protein Human IL12B (Interleukin 12B) expressed in Sf9 for Antibody Discovery (CAT#: MP0128Q)

Datasheet
This product is a 37 kDa Human IL12B membrane protein expressed in Sf9. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IL12B
  • Protein Length
  • Full-length
  • Protein Class
  • Druggable Genome, Secreted Protein, Transmembrane
  • Molecular Weight
  • 37 kDa
  • Sequence
  • MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Product Description

  • Expression Systems
  • Sf9
  • Tag
  • C-DDK
  • Purity
  • > 80% as determined by SDS-PAGE and Coomassie blue staining
  • Buffer
  • 50mM Tris-HCl pH8.0, 150mM NaCl, 20% glycerol

Target

  • Target Protein
  • IL12B
  • Full Name
  • Interleukin 12B
  • Introduction
  • This gene encodes a subunit of interleukin 12, a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. Interleukin 12 is a disulfide-linked heterodimer composed of the 40 kD cytokine receptor like subunit encoded by this gene, and a 35 kD subunit encoded by IL12A. This cytokine is expressed by activated macrophages that serve as an essential inducer of Th1 cells development. This cytokine has been found to be important for sustaining a sufficient number of memory/effector Th1 cells to mediate long-term protection to an intracellular pathogen. Overexpression of this gene was observed in the central nervous system of patients with multiple sclerosis (MS), suggesting a role of this cytokine in the pathogenesis of the disease. The promoter polymorphism of this gene has been reported to be associated with the severity of atopic and non-atopic asthma in children.
  • Alternative Names
  • CLMF; CLMF2; IMD28; IMD29; NKSF; NKSF2; interleukin-12 subunit beta; p40; NK cell stimulatory factor chain 2; IL-12 subunit p40; IL12, subunit p40; cytotoxic lymphocyte maturation factor 40 kDa subunit; interleukin 12, interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte; maturation factor 2, p40); interleukin-12 beta chain; natural killer cell stimulatory factor, 40 kD subunit; IL-12B

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us