Close

Magic™ Membrane Protein Human IL1R1 (Interleukin 1 receptor type 1) Full Length (CAT#: MPC1731K)

Datasheet Made to Order
This product is a 65.4 kDa Human IL1R1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IL1R1
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • Molecular Weight
  • 65.4 kDa
  • TMD
  • 1
  • Sequence
  • MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNE
    HKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRN
    SSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKN
    ENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASY
    TYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNV
    TGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISE
    IESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQKHMIGICVTLTVIIV
    CSVFIYKIFKIDIVLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGST
    SDCDIFVFKVLPEVLEKQCGYKLFIYGRDDYVGEDIVEVINENVKKSRRL
    IIILVRETSGFSWLGGSSEEQIAMYNALVQDGIKVVLLELEKIQDYEKMP
    ESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYHMPVQRRSPSSKHQ
    LLSPATKEKLQREAHVPLG

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Flag-StrepII or based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements
  • Form
  • Liquid
  • Storage
  • Aliquot and store at -20°C or lower. For long term storage, we recommend to store at -70°C or lower. Avoid freeze/thaw cycles.

Target

  • Target Protein
  • IL1R1
  • Full Name
  • Interleukin 1 receptor type 1
  • Introduction
  • This gene encodes a cytokine receptor that belongs to the interleukin-1 receptor family. The encoded protein is a receptor for interleukin-1 alpha, interleukin-1 beta, and interleukin-1 receptor antagonist. It is an important mediator involved in many cytokine-induced immune and inflammatory responses. This gene is located in a cluster of related cytokine receptor genes on chromosome 2q12.
  • Alternative Names
  • IL1R1; P80; IL1R; IL1RA; CD121A; D2S1473; IL-1R-alpha; interleukin-1 receptor type 1; CD121 antigen-like family member A; IL-1R-1; IL-1RT-1; IL-1RT1; interleukin 1 receptor alpha, type I; interleukin-1 receptor alpha; interleukin-1 receptor type I; Interleukin 1 receptor type 1

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Related Products

Online Inquiry

CONTACT US

USA:
Europe:
Call us at:
USA:
Europe:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us