Close

Magic™ Membrane Protein Human KCNE1 (Potassium voltage-gated channel subfamily E regulatory subunit 1) Full Length (CAT#: MPC0359K) Made to Order

This product is a 14.6 kDa Human KCNE1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KCNE1
  • Protein Length
  • Full length
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 14.6 kDa
  • TMD
  • 1
  • Sequence
  • MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMV
    LGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVL
    ESYRSCYVVENHLAIEQPNTHLPETKPSP

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • Flag-StrepII or based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • KCNE1
  • Full Name
  • Potassium voltage-gated channel subfamily E regulatory subunit 1
  • Introduction
  • The product of this gene belongs to the potassium channel KCNE family. Potassium ion channels are essential to many cellular functions and show a high degree of diversity, varying in their electrophysiologic and pharmacologic properties. This gene encodes a transmembrane protein known to associate with the product of the KVLQT1 gene to form the delayed rectifier potassium channel. Mutation in this gene are associated with both Jervell and Lange-Nielsen and Romano-Ward forms of long-QT syndrome. Alternatively spliced transcript variants encoding the same protein have been identified.
  • Alternative Names
  • ISK; JLNS; LQT5; MinK; JLNS2; LQT2/5; potassium voltage-gated channel subfamily E member 1; IKs producing slow voltage-gated potassium channel subunit beta Mink; Long QT syndrome 5
    cardiac delayed rectifier potassium channel protein; delayed rectifier potassium channel subunit IsK; minimal potassium channel; potassium channel, voltage gated subfamily E regulatory beta subunit 1; potassium voltage-gated channel, Isk-related family, member 1; potassium voltage-gated channel, Isk-related subfamily, member 1; voltage gated potassiun channel accessory subunit; KCNE1; Potassium voltage-gated channel subfamily E regulatory subunit 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us