Close

Magic™ Membrane Protein Human KCNJ1 (Potassium inwardly rectifying channel subfamily J member 1) expressed in Yeast for Antibody Discovery (CAT#: MP1368J)

This product is a 26.3 kDa Human KCNJ1 membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KCNJ1
  • Protein Length
  • Partial (178-391aa)
  • Protein Class
  • Ion Channel
  • Molecular Weight
  • 26.3 kDa
  • Sequence
  • ILAKISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGTVESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLYNEKDVRARMKRGYDNPNFILSEVNETDDTKM

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • N-6xHis
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Liquid: Tris/PBS-based buffer, 5%-50% glycerol
    Lyophilized powder: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • KCNJ1
  • Full Name
  • Potassium inwardly rectifying channel subfamily J member 1
  • Introduction
  • Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. It is activated by internal ATP and probably plays an important role in potassium homeostasis. The encoded protein has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Mutations in this gene have been associated with antenatal Bartter syndrome, which is characterized by salt wasting, hypokalemic alkalosis, hypercalciuria, and low blood pressure. Multiple transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • ATP regulated potassium channel ROM K; ATP sensitive inward rectifier potassium channel 1; ATP-regulated potassium channel ROM-K; ATP-sensitive inward rectifier potassium channel 1; Inward rectifier K(+) channel Kir1.1; inwardly rectifying K+ channel; inwardly rectifying subfamily J member 1; IRK1_HUMAN; KCNJ 1; KCNJ; Kcnj1; Kir 1.1; Kir1.1; OTTHUMP00000045938; Potassium channel; Potassium channel inwardly rectifying subfamily J member 1; potassium inwardly-rectifying channel J1; ROMK 1; ROMK 2; ROMK; ROMK1; ROMK2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us