Close

Magic™ Membrane Protein Human KCNJ10 (Potassium inwardly rectifying channel subfamily J member 10) for Antibody Discovery (CAT#: MP1367J)

This product is a 39.8 kDa Human KCNJ10 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KCNJ10
  • Protein Length
  • Partial (165-379aa)
  • Protein Class
  • Ion Channel
  • Molecular Weight
  • 39.8 kDa
  • Sequence
  • FLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-6xHis-SUMO
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Liquid: Tris/PBS-based buffer, 5%-50% glycerol
    Lyophilized powder: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • KCNJ10
  • Full Name
  • Potassium inwardly rectifying channel subfamily J member 10
  • Introduction
  • This gene encodes a member of the inward rectifier-type potassium channel family, characterized by having a greater tendency to allow potassium to flow into, rather than out of, a cell. The encoded protein may form a heterodimer with another potassium channel protein and may be responsible for the potassium buffering action of glial cells in the brain. Mutations in this gene have been associated with seizure susceptibility of common idiopathic generalized epilepsy syndromes.
  • Alternative Names
  • inwardly rectifying subfamily J member 10; ATP dependent inwardly rectifying potassium channel Kir4.1; ATP sensitive inward rectifier potassium channel 10; ATP-dependent inwardly rectifying potassium channel Kir4.1; ATP-sensitive inward rectifier potassium channel 10; BIRK10; Glial ATP dependent inwardly rectifying potassium channel KIR4.1; Inward rectifier K(+) channel Kir1.2; Inward rectifier K+ channel KIR1.2; Inwardly rectifying potassium channel Kir1.2; KCJ10_HUMAN; KCNJ 10; Kcnj10; KCNJ13 PEN; KIR1.2; KIR4.1; Potassium channel; Potassium channel inwardly rectifying subfamily J member 10; Potassium inwardly rectifying channel subfamily J member 10; SESAME

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us