Close

Magic™ Membrane Protein Human KIR2DS1 (Killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 1) Expressed in Yeast with 6xHis tag at the N-terminus for Antibody Discovery, Partial (22-245aa) (CAT#: MPX4230K)

This product is a 26.8kDa Human KIR2DS1 membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KIR2DS1
  • Protein Length
  • Partial (22-245aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 26.8kDa
  • TMD
  • 1
  • Sequence
  • HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMRQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • KIR2DS1
  • Full Name
  • Killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 1
  • Introduction
  • Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response.
  • Alternative Names
  • KIR2DS1; p50.1; CD158H; CD158a; killer cell immunoglobulin-like receptor 2DS1; CD158 antigen-like family member H; MHC class I NK cell receptor Eb6 ActI; killer cell immunoglobulin-like receptor KIRDS1; killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1; killer-cell immunoglobulin-like receptor; Killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us