Close

Magic™ Membrane Protein Human KLRK1 (Killer cell lectin like receptor K1) for Antibody Discovery (CAT#: MP1506J)

This product is a 43.6 kDa Human KLRK1 membrane protein expressed in Mammalian cell. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KLRK1
  • Protein Length
  • Partial (78-216aa)
  • Protein Class
  • Immune Checkpoints
  • Molecular Weight
  • 43.6 kDa
  • TMD
  • 1
  • Sequence
  • FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV

Product Description

  • Activity
  • Validated by ELISA
  • Expression Systems
  • Mammalian cell
  • Tag
  • C-hFc
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Endotoxin
  • <1.0 EU/μg
  • Purity
  • >93% as determined by SDS-PAGE
  • Buffer
  • 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Target

  • Target Protein
  • KLRK1
  • Full Name
  • Killer cell lectin like receptor K1
  • Introduction
  • Functions as an activating and costimulatory receptor involved in immunosurveillance upon binding to various cellular stress-inducible ligands displayed at the surface of autologous tumor cells and virus-infected cells. Provides both stimulatory and costimulatory innate immune responses on activated killer (NK) cells, leading to cytotoxic activity. Acts as a costimulatory receptor for T-cell receptor (TCR) in CD8+ T-cell-mediated adaptive immune responses by amplifying T-cell activation. Stimulates perforin-mediated elimination of ligand-expressing tumor cells. Signaling involves calcium influx, culminating in the expression of TNF-alpha. Participates in NK cell-mediated bone marrow graft rejection. May play a regulatory role in differentiation and survival of NK cells. Binds to ligands belonging to various subfamilies of MHC class I-related glycoproteins including MICA, MICB, RAET1E, RAET1G, RAET1L/ULBP6, ULBP1, ULBP2, ULBP3 (ULBP2>ULBP1>ULBP3) and ULBP4.
  • Alternative Names
  • KLR; CD314; NKG2D; NKG2-D; D12S2489E; CD314 antigen; D12S2489E; Killer cell lectin like receptor subfamily K member 1; Killer cell lectin-like receptor subfamily K member 1; KLR; KLRC4 KLRK1 readthrough; KLRK1; NK cell receptor D; NK lectin-like receptor; NKG2 D activating NK receptor; NKG2 D type II integral membrane protein; NKG2-D type II integral membrane protein; NKG2-D-activating NK receptor; Nkg2d; NKG2D_HUMAN; NKLLR; NKR P2; Nkrp2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us