Close

Magic™ Membrane Protein Human LAIR1 (Leukocyte associated immunoglobulin like receptor 1) Expressed in HEK293 for Antibody Discovery, Partial (22-163aa) (CAT#: MPX0716K)

This product is a 42 kDa Human LAIR1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • LAIR1
  • Protein Length
  • Partial (22-163aa)
  • Protein Class
  • Receptor; Immunity
  • Molecular Weight
  • 42 kDa
  • TMD
  • 1
  • Sequence
  • QEEDLPRPSISAEPGTVIPLGSHVTFVCRGPVGVQTFRL
    ERDSRSTYNDTEDVSQASPSESEARFRIDSVREGNAGLYRCIYYKPPKWSEQSDYLELLV
    KESSGGPDSPDTEPGSSAGPTQRPSDNSHNEHAPASQGLKAEH

Product Description

  • Activity
  • Yes
  • Expression Systems
  • HEK293
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.

Target

  • Target Protein
  • LAIR1
  • Full Name
  • Leukocyte associated immunoglobulin like receptor 1
  • Introduction
  • The protein encoded by this gene is an inhibitory receptor found on peripheral mononuclear cells, including natural killer cells, T cells, and B cells. Inhibitory receptors regulate the immune response to prevent lysis of cells recognized as self. The gene is a member of both the immunoglobulin superfamily and the leukocyte-associated inhibitory receptor family. The gene maps to a region of 19q13.4 called the leukocyte receptor cluster, which contains at least 29 genes encoding leukocyte-expressed receptors of the immunoglobulin superfamily. The encoded protein has been identified as an anchor for tyrosine phosphatase SHP-1, and may induce cell death in myeloid leukemias. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • LAIR1; CD305; LAIR-1; leukocyte-associated immunoglobulin-like receptor 1; immunoglobulin heavy chain variable region; leukocyte-associated Ig-like receptor 1; Leukocyte associated immunoglobulin like receptor 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us