Close

Magic™ Membrane Protein Human LILRB2 (Leukocyte immunoglobulin like receptor B2) without tag for Antibody Discovery (CAT#: MP0638X)

This product is a 21.2 kDa Human LILRB2 membrane protein expressed in in vitro wheat germ expression system with proprietary liposome technology. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • LILRB2
  • Protein Length
  • Full-length
  • Molecular Weight
  • 21.2 kDa
  • TMD
  • 1
  • Sequence
  • MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRRV

Product Description

  • Application
  • Antibody Production
  • Expression Systems
  • in vitro wheat germ expression system with proprietary liposome technology
  • Tag
  • NO
  • Purification
  • None
  • Buffer
  • 25 mM Tris-HCl of pH8.0 containing 2% glycerol

Target

  • Target Protein
  • LILRB2
  • Full Name
  • Leukocyte immunoglobulin like receptor B2
  • Introduction
  • This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thoµght to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene
  • Alternative Names
  • ILT4; LIR2; CD85D; ILT-4; LIR-2; MIR10; MIR-10

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us