Close

Magic™ Membrane Protein Human LTBR (Lymphotoxin beta receptor) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX3889K)

This product is a Human LTBR membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • LTBR
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMLAVLLPLAFFLLLATVFSCIWKSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEPPKAHPYFPDLVQPLLPISGDVSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPGEQSQVAHGTNGIHVTGGSMTITGNIYIYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGATPSNRGPRNQFITHD

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis and SUMO tag
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • LTBR
  • Full Name
  • Lymphotoxin beta receptor
  • Introduction
  • This gene encodes a member of the tumor necrosis factor receptor superfamily. The major ligands of this receptor include lymphotoxin alpha/beta and tumor necrosis factor ligand superfamily member 14. The encoded protein plays a role in signalling during the development of lymphoid and other organs, lipid metabolism, immune response, and programmed cell death. Activity of this receptor has also been linked to carcinogenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed.
  • Alternative Names
  • LTBR; TNFCR; TNFR3; D12S370; TNFR-RP; TNFRSF3; TNFR2-RP; LT-BETA-R; TNF-R-III; tumor necrosis factor receptor superfamily member 3; lymphotoxin B receptor; lymphotoxin beta receptor (TNFR superfamily, member 3); tumor necrosis factor C receptor; tumor necrosis factor receptor 2-related protein; tumor necrosis factor receptor type III; Lymphotoxin beta receptor

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us