Close

Magic™ Membrane Protein Human NDUFA1 (NADH:ubiquinone oxidoreductase subunit A1) Full Length (CAT#: MPC4439K) Made to Order

This product is a made-to-order Human NDUFA1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NDUFA1
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • TMD
  • 1
  • Sequence
  • MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMER
    DRRISGVDRYYVSKGLENID

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Flag-StrepII or based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, SMALPs, VLP)

Target

  • Target Protein
  • NDUFA1
  • Full Name
  • NADH:ubiquinone oxidoreductase subunit A1
  • Introduction
  • The human NDUFA1 gene codes for an essential component of complex I of the respiratory chain, which transfers electrons from NADH to ubiquinone. It has been noted that the N-terminal hydrophobic domain has the potential to be folded into an alpha-helix spanning the inner mitochondrial membrane with a C-terminal hydrophilic domain interacting with globular subunits of complex I. The highly conserved two-domain structure suggests that this feature is critical for the protein function and might act as an anchor for the NADH:ubiquinone oxidoreductase complex at the inner mitochondrial membrane. However, the NDUFA1 peptide is one of about 31 components of the "hydrophobic protein" (HP) fraction of complex I which is involved in proton translocation. Thus the NDUFA1 peptide may also participate in that function.
  • Alternative Names
  • NDUFA1; MWFE; ZNF183; CI-MWFE; MC1DN12; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa; NADH-ubiquinone oxidoreductase MWFE subunit; NADH:ubiquinone oxidoreductase (complex 1); complex I MWFE subunit; type I dehydrogenase; NADH:ubiquinone oxidoreductase subunit A1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us