Close

Magic™ Membrane Protein Human PTPRG (Protein tyrosine phosphatase receptor type G) for Antibody Discovery (CAT#: MP1066X)

This product is a 37.8 kDa Human PTPRG membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PTPRG
  • Protein Length
  • Full-length
  • Molecular Weight
  • 37.8 kDa
  • TMD
  • 1
  • Sequence
  • MRRLLEPCWWILFLKITSSVLHYVVCFPALTEGYVGALHENRHGSAVQIRRRKASGDPYWAYSGKSSCSNGDHTGQLTSHSTHLKAHFESLLCLSSVCSNLS

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCl, 150 mM NaCl, 0.05% Brij35, 1 mM DTT, 10% glycerol, pH7.5

Target

  • Target Protein
  • PTPRG
  • Full Name
  • Protein tyrosine phosphatase receptor type G
  • Introduction
  • The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and two tandem intracytoplasmic catalytic domains, and thus represents a receptor-type PTP. The extracellular region of this PTP contains a carbonic anhydrase-like (CAH) domain, which is also found in the extracellular region of PTPRBETA/ZETA. This gene is located in a chromosomal region that is frequently deleted in renal cell carcinoma and lung carcinoma, thus is thought to be a candidate tumor suppressor gene.
  • Alternative Names
  • PTPG; HPTPG; RPTPG; R-PTP-GAMMA; receptor-type tyrosine-protein phosphatase gamma; H_RG317H01.1; protein tyrosine phosphatase gamma; protein tyrosine phosphatase, receptor type, gamma polypeptide; receptor type protein tyrosine phosphatase gamma; receptor tyrosine phosphatase gamma; receptor-type protein phosphatase gamma

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us