Close

Magic™ Membrane Protein Human PTPRZ1 (Protein tyrosine phosphatase receptor type Z1) Expressed in E.coli with 6xHis and SUMO tag at the N-terminus for Antibody Discovery, Partial (36-300aa) (CAT#: MPX4498K)

This product is a 46.1kDa Human PTPRZ1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PTPRZ1
  • Protein Length
  • Partial (36-300aa)
  • Protein Class
  • Protein phosphatase
  • Molecular Weight
  • 46.1kDa
  • TMD
  • 1
  • Sequence
  • IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis and SUMO tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • PTPRZ1
  • Full Name
  • Protein tyrosine phosphatase receptor type Z1
  • Introduction
  • This gene encodes a member of the receptor protein tyrosine phosphatase family. Expression of this gene is restricted to the central nervous system (CNS), and it may be involved in the regulation of specific developmental processes in the CNS. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
  • Alternative Names
  • PTPRZ1; PTPZ; HPTPZ; PTP18; PTPRZ; RPTPB; HPTPzeta; PTP-ZETA; RPTPbeta; phosphacan; R-PTP-zeta-2; receptor-type tyrosine-protein phosphatase zeta; protein tyrosine phosphatase, receptor-type, Z polypeptide 1; protein tyrosine phosphatase, receptor-type, zeta polypeptide 1; protein-tyrosine phosphatase receptor type Z polypeptide 2; receptor-type tyrosine phosphatase beta/zeta; Protein tyrosine phosphatase receptor type Z1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us