Close
Close

Magic™ Membrane Protein Human PTRH2 (Peptidyl-tRNA hydrolase 2) for Antibody Discovery (CAT#: MP0016Q)

Datasheet
This product is a 14.9 kDa Human PTRH2 membrane protein expressed in E. col. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PTRH2
  • Protein Length
  • Partial
  • Protein Class
  • Transmembrane
  • Molecular Weight
  • 14.9 kDa
  • Sequence
  • MGSSHHHHHHSSGLVPRGSHMEYKMILVVR NDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSL IQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY

Product Description

  • Expression Systems
  • E. coli
  • Tag
  • His
  • Purification
  • Conventional chromatography
  • Purity
  • >95%
  • Buffer
  • 20mM Tris buffer (pH 8.0) containing 10% glycerol, 1mM DTT

Target

  • Target Protein
  • PTRH2
  • Full Name
  • Peptidyl-tRNA hydrolase 2
  • Introduction
  • The protein encoded by this gene is a mitochondrial protein with two putative domains, an N-terminal mitochondrial localization sequence, and a UPF0099 domain. in vitro assays suggest that this protein possesses peptidyl-tRNA hydrolase activity, to release the peptidyl moiety from tRNA, thereby preventing the accumulation of dissociated peptidyl-tRNA that could reduce the efficiency of translation. This protein also plays a role regulating cell survival and death. It promotes survival as part of an integrin-signaling pathway for cells attached to the extracellular matrix (ECM), but also promotes apoptosis in cells that have lost their attachment to the ECM, a process called anoikos. After loss of cell attachment to the ECM, this protein is phosphorylated, is released from the mitochondria into the cytosol, and promotes caspase-independent apoptosis through interactions with transcriptional regulators. This gene has been implicated in the development and progression of tumors, and mutations in this gene have been associated with an infantile multisystem neurologic, endocrine, and pancreatic disease (INMEPD) characterized by intellectual disability, postnatal microcephaly, progressive cerebellar atrophy, hearing impairment, polyneuropathy, failure to thrive, and organ fibrosis with exocrine pancreas insufficiency (PMID: 25574476). Alternative splicing results in multiple transcript variants encoding different isoforms.
  • Alternative Names
  • BIT1; CFAP37; CGI-147; IMNEPD; PTH; PTH 2; PTH2; peptidyl-tRNA hydrolase 2, mitochondrial; bcl-2 inhibitor of transcription 1; cilia and flagella associated protein 37

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us