Close
Close

Magic™ Membrane Protein Human RHD (Rh blood group D antigen) Expressed in E.coli with 6xHis and GST tag at the N-terminus for Antibody Discovery, Partial (388-417aa) (CAT#: MPX4319K)

Datasheet
This product is a 33.6 kDa Human RHD membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • RHD
  • Protein Length
  • Partial (388-417aa)
  • Protein Class
  • Blood group antigen
  • Molecular Weight
  • 33.6 kDa
  • TMD
  • 11
  • Sequence
  • LNLKIWKAPHEAKYFDDQVFWKFPHLAVGF

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis and GST tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • RHD
  • Full Name
  • Rh blood group D antigen
  • Introduction
  • The Rh blood group system is the second most clinically significant of the blood groups, second only to ABO. It is also the most polymorphic of the blood groups, with variations due to deletions, gene conversions, and missense mutations. The Rh blood group includes this gene, which encodes the RhD protein, and a second gene that encodes both the RhC and RhE antigens on a single polypeptide. The two genes, and a third unrelated gene, are found in a cluster on chromosome 1. The classification of Rh-positive and Rh-negative individuals is determined by the presence or absence of the highly immunogenic RhD protein on the surface of erythrocytes. Multiple transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • RHD; RH; Rh4; RH30; RhII; RhPI; DIIIc; RHCED; RHDel; RHPII; RhDCw; CD240D; RHXIII; RHDVA(TT); RhK562-II; blood group Rh(D) polypeptide; D antigen (DCS); RH polypeptide 2; Rh blood group C antigen; Rh blood group CcEe antigen; Rh blood group D antigen weak D type 160; Rh blood group antigen Evans; Rh blood group, D anitgen; RhD antigen; RhD blood group antigen; RhD polypeptide; Rhesus D blood group protein; Rhesus blood group D antigen allele DIII type 7; Rhesus blood group antigen D; Rhesus system D polypeptide; blood group antigen D; blood group protein RHD; rhesus D antigen; truncated Rh blood group D antigen; truncated RhD antigen; truncated rhesus D; truncated rhesus blood group D antigen; Rh blood group D antigen

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us