Magic™ Membrane Protein Human SCN1A (Sodium voltage-gated channel alpha subunit 1) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, Partial (1-128aa) (CAT#: MPX4148K)

Datasheet

This product is a 18.5 kDa Human SCN1A membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

Host Species
Human

Target Protein
SCN1A

Protein Length
Partial (1-128aa)

Protein Class
Transporter; Ion channel

Molecular Weight
18.5 kDa

Sequence
MEQTVLVPPGPDSFNFFTRESLAAIERRIAEEKAKNPKPDKKDDDENGPKPNSDLEAGKNLPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAIFRFSATSALYILTPFNPLRKIAIKILVHS

Product Description

Expression Systems
E.coli

Tag
6xHis tag at the N-terminus

Protein Format
Soluble

Purity
>85% as determined by SDS-PAGE.

Buffer
Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

Target Protein
SCN1A

Full Name
Sodium voltage-gated channel alpha subunit 1

Introduction
Voltage-dependent sodium channels are heteromeric complexes that regulate sodium exchange between intracellular and extracellular spaces and are essential for the generation and propagation of action potentials in muscle cells and neurons. Each sodium channel is composed of a large pore-forming, glycosylated alpha subunit and two smaller beta subunits. This gene encodes a sodium channel alpha subunit, which has four homologous domains, each of which contains six transmembrane regions. Allelic variants of this gene are associated with generalized epilepsy with febrile seizures and epileptic encephalopathy. Alternative splicing results in multiple transcript variants. The RefSeq Project has decided to create four representative RefSeq records. Three of the transcript variants are supported by experimental evidence and the fourth contains alternate 5' untranslated exons, the exact combination of which have not been experimentally confirmed for the full-length transcript.

Alternative Names
DEE6; DRVT; FEB3; FHM3; NAC1; SCN1; SMEI; EIEE6; FEB3A; HBSCI; GEFSP2; Nav1.1; sodium channel protein type 1 subunit alpha; sodium channel protein type I subunit alpha; sodium channel protein, brain I alpha subunit; sodium channel voltage gated type 1 alpha subunit; sodium channel, voltage-gated, type I, alpha polypeptide; sodium channel, voltage-gated, type I, alpha subunit; voltage-gated sodium channel subunit alpha Nav1.1; SCN1A; Sodium voltage-gated channel alpha subunit 1

Gene ID
6323

UniProt ID
P35498

Customer reviews and Q&As Write a review Ask a question

Related Products

Online Inquiry

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: