Close

Magic™ Membrane Protein Human SFTPA1 (Surfactant protein A1) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX0965K)

This product is a Human SFTPA1 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SFTPA1
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Receptor
  • Molecular Weight
  • 41.2kDa
  • Sequence
  • EVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis and B2M tag at the N-terminus, Myc tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • SFTPA1
  • Full Name
  • Surfactant protein A1
  • Introduction
  • This gene encodes a lung surfactant protein that is a member of a subfamily of C-type lectins called collectins. The encoded protein binds specific carbohydrate moieties found on lipids and on the surface of microorganisms. This protein plays an essential role in surfactant homeostasis and in the defense against respiratory pathogens. Mutations in this gene are associated with idiopathic pulmonary fibrosis. Alternate splicing results in multiple transcript variants.
  • Alternative Names
  • SFTPA1; SPA; PSAP; PSPA; SP-A; SPA1; PSP-A; SFTP1; SP-A1; COLEC4; SFTPA1B; SP-A1 beta; SP-A1 delta; SP-A1 gamma; SP-A1 epsilon; pulmonary surfactant-associated protein A1; 35 kDa pulmonary surfactant-associated protein; alveolar proteinosis protein; collectin-4; surfactant protein A1B; surfactant, pulmonary-associated protein A1A; surfactant, pulmonary-associated protein A1B; Surfactant protein A1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us