Close

Magic™ Membrane Protein Human SLC25A1 (Solute carrier family 25 member 1) Expressed in E.coli with GST tag at the N-terminus for Antibody Discovery, Partial (47-87aa) (CAT#: MPX4386K)

This product is a 31.8kDa Human SLC25A1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLC25A1
  • Protein Length
  • Partial (47-87aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 31.8kDa
  • TMD
  • 6
  • Sequence
  • EYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGL

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • GST tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • SLC25A1
  • Full Name
  • Solute carrier family 25 member 1
  • Introduction
  • This gene encodes a member of the mitochondrial carrier subfamily of solute carrier proteins. Members of this family include nuclear-encoded transporters that translocate small metabolites across the mitochondrial membrane. This protein regulates the movement of citrate across the inner membranes of the mitochondria. Mutations in this gene have been associated with combined D-2- and L-2-hydroxyglutaric aciduria. Pseudogenes of this gene have been identified on chromosomes 7, 11, 16, and 19. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • SLC25A1; CTP; SEA; CMS23; D2L2AD; SLC20A3; tricarboxylate transport protein, mitochondrial; citrate transport protein; solute carrier family 20 (mitochondrial citrate transporter), member 3; solute carrier family 25 (mitochondrial carrier; citrate transporter), member 1; tricarboxylate carrier protein; Solute carrier family 25 member 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us