Close

Magic™ Membrane Protein Human SLC30A5 (Solute carrier family 30 member 5) for Antibody Discovery (CAT#: MP1209X)

This product is a 38.72 kDa Human SLC30A5 membrane protein expressed in In vitro wheat germ expression system with proprietary liposome technology. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLC30A5
  • Protein Length
  • Full-length
  • Molecular Weight
  • 38.72 kDa
  • TMD
  • 16
  • Sequence
  • MEEKYGGDVLAGPGGGGGLGPVDVPSARLTKYIVLLCFTKFLKAVGLFESYDLLKAVHIVQFIFILKLGTAFFMVLFQKPFSSGKTITKHQIIGSLKIPGRKEFKDKKLNDPRKLVGN

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • In vitro wheat germ expression system with proprietary liposome technology
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0

Target

  • Target Protein
  • SLC30A5
  • Full Name
  • Solute carrier family 30 member 5
  • Introduction
  • This gene encodes a member of the SLC30A/ZnT family of zinc transporter proteins. ZnT proteins mediate both cellular zinc efflux and zinc sequestration into membrane-bound organelles. The encoded protein plays a role in the early secretory pathway as a heterodimer with zinc transporter 6, and may also regulate zinc sequestration into secretory granules of pancreatic beta cells. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 19.
  • Alternative Names
  • ZNT5; ZTL1; ZNTL1; ZnT-5; zinc transporter 5; solute carrier family 30 (zinc transporter), member 5; zinc transporter ZTL1; znT-like transporter 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us