Close

Magic™ Membrane Protein Human ST6GAL1 (ST6 beta-galactoside alpha-2,6-sialyltransferase 1) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX0950K)

This product is a Human ST6GAL1 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ST6GAL1
  • Protein Length
  • Full Length
  • Protein Class
  • Transferase
  • Molecular Weight
  • 52.1kDa
  • TMD
  • 1
  • Sequence
  • MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • ST6GAL1
  • Full Name
  • ST6 beta-galactoside alpha-2,6-sialyltransferase 1
  • Introduction
  • This gene encodes a member of glycosyltransferase family 29. The encoded protein is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein, which is normally found in the Golgi but can be proteolytically processed to a soluble form, is involved in the generation of the cell-surface carbohydrate determinants and differentiation antigens HB-6, CD75, and CD76. This gene has been incorrectly referred to as CD75. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • ST6GAL1; ST6N; SIAT1; ST6GalI; beta-galactoside alpha-2,6-sialyltransferase 1; B-cell antigen CD75; CMP-N-acetylneuraminate beta-galactosamide alpha-2,6-sialyltransferase; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1; ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 1; ST6 beta-galactosamide alpha-2,6-sialyltranferase 1; alpha 2,6-ST 1; sialyltransferase 1 (beta-galactoside alpha-2,6-sialyltransferase); ST6 beta-galactoside alpha-2,6-sialyltransferase 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us