Close

Magic™ Membrane Protein Human TGFBR1 (Transforming growth factor beta receptor 1) Expressed in NS0 for Antibody Discovery, Partial (25-125aa) (CAT#: MPX0235K)

This product is a 37 kDa Human TGFBR1 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TGFBR1
  • Protein Length
  • Partial (25-125aa)
  • Protein Class
  • Transferase
  • Molecular Weight
  • 37 kDa
  • TMD
  • 1
  • Sequence
  • AALLPGATALQCFCHLCTKDNFTCVT
    DGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYC
    CNQDHCNKIELPTTVKSSPGLGPVE

Product Description

  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 250 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • TGFBR1
  • Full Name
  • Transforming growth factor beta receptor 1
  • Introduction
  • The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. The encoded protein is a serine/threonine protein kinase. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). Multiple transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • TGFBR1; AAT5; ALK5; ESS1; LDS1; MSSE; SKR4; TBRI; ALK-5; LDS1A; LDS2A; TBR-i; TGFR-1; ACVRLK4; tbetaR-I; TGF-beta receptor type-1; activin A receptor type II-like kinase, 53kDa; activin A receptor type II-like protein kinase of 53kD; activin receptor-like kinase 5; mutant transforming growth factor beta receptor I; serine/threonine-protein kinase receptor R4; transforming growth factor beta receptor I; transforming growth factor-beta receptor type I; Transforming growth factor beta receptor 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us