Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
With over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications.
Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
With deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
Creative Biolabs is one of the world’s leading contract organizations (CRO) that has extensive experience in preclinical drug discovery. Our employees are at the core of our success, with the ambition to improving health and increasing access to quality health solutions worldwide. We believe when curious, courageous and collaborative people like you are brought together, a big difference will be made for the development of innovate medicines.
Get a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
This product is a 22.7 kDa Human TLCD4-RWDD3 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Host Species
Human
Target Protein
TLCD4-RWDD3
Protein Length
Full length
Protein Class
Transporter
Molecular Weight
22.7 kDa
TMD
3
Sequence
MEINTKLLISVTCISFFTFQLLFYFVSYWFSAKVSPGFNSLSFKKKIEWN SRVVSTCHSLVVGIFGLYIFLFDEATKADPLWGGPSLANVNIAIASGYLI SDLSIIILYWKVIGDKFFIMHHCASLYAYYLVLKNGVLAYIGNFRLLAEL SSPFVNQRPKAVVTGNMDLFSSLTLHLSTLSLQSPANNQDRWDRVQNSHK S
Product Description
Expression Systems
HEK293
Tag
Flag-StrepII or based on specific requirements
Protein Format
Detergent or based on specific requirements
Target
Target Protein
TLCD4-RWDD3
Full Name
TLCD4-RWDD3 readthrough
Introduction
This locus represents naturally occurring read-through transcription between the neighboring TMEM56 (transmembrane protein 56) and RWDD3 (RWD domain containing 3) genes on chromosome 1. The read-through transcript encodes a protein that shares sequence identity with the upstream gene product, but it contains a distinct C-terminus due to frameshifts versus the downstream gene coding sequence.