Close

Magic™ Membrane Protein Human TMEM97 (Transmembrane protein 97) (CAT#: MP0009J)

This product is a 20.7 kDa Human TMEM97 membrane protein expressed in HEK293T. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TMEM97
  • Protein Length
  • Full-length
  • Protein Class
  • Transmembrane
  • Molecular Weight
  • 20.7 kDa
  • TMD
  • 4
  • Sequence
  • MGAPATRRCVEWLLGLYFLSHIPITLFMDLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQEPPAWFKSFL
    FCELVFQLPFFPIATYAFLKGSCKWIRTPAIIYSVHTMTTLIPILSTFLFEDFSKASGFKGQRPETLHER
    LTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK

Product Description

  • Expression Systems
  • HEK293T
  • Tag
  • C-Myc/DDK
  • Form
  • Powder
  • Purification
  • Anti-DDK affinity column followed by conventional chromatography steps
  • Purity
  • > 80% as determined by SDS-PAGE and Coomassie blue staining
  • Buffer
  • 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
  • Storage
  • Store at +4°C for up to one week or several months at -80°C

Target

  • Target Protein
  • TMEM97
  • Full Name
  • Transmembrane protein 97
  • Introduction
  • Intracellular orphan receptor that binds numerous drugs and which is highly expressed in various proliferating cancer cells. Corresponds to the sigma-2 receptor, which is thought to play important role in regulating cell survival, morphology and differentiation. Under investigation for its potential diagnostic and therapeutic uses. May play a role as a regulator of cellular cholesterol homeostasis. May function as sterol isomerase. May alter the activity of some cytochrome P450 proteins.
  • Alternative Names
  • MAC30; sigma intracellular receptor 2; meningioma-associated protein 30; sigma-2 receptor; sigma2 receptor

Related Products

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

USA:
Europe: UK - Germany
Call us at:
USA:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us