Close

Magic™ Membrane Protein Human VTCN1 (V-set domain containing T cell activation inhibitor 1) Expressed in E.coli with GST tag at the N-terminus for Antibody Discovery, Partial (26-258aa) (CAT#: MPX4397K)

This product is a 52.6kDa Human VTCN1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • VTCN1
  • Protein Length
  • Partial (26-258aa)
  • Protein Class
  • Immunity
  • Molecular Weight
  • 52.6kDa
  • TMD
  • 1
  • Sequence
  • IIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKA

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • GST tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • VTCN1
  • Full Name
  • V-set domain containing T cell activation inhibitor 1
  • Introduction
  • This gene encodes a protein belonging to the B7 costimulatory protein family. Proteins in this family are present on the surface of antigen-presenting cells and interact with ligand bound to receptors on the surface of T cells. Studies have shown that high levels of the encoded protein has been correlated with tumor progression. A pseudogene of this gene is located on chromosome 20. Multiple transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • VTCN1; B7X; B7H4; B7S1; B7-H4; B7h.5; VCTN1; PRO1291; V-set domain-containing T-cell activation inhibitor 1; B7 family member, H4; B7 homolog 4; B7 superfamily member 1; T cell costimulatory molecule B7x; immune costimulatory protein B7-H4; V-set domain containing T cell activation inhibitor 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us