Close
Close

Magic™ Membrane Protein Mouse Havcr2 (Hepatitis A virus cellular receptor 2) for Antibody Discovery (CAT#: MP1497J)

Datasheet
This product is a 46.3 kDa Mouse Havcr2 membrane protein expressed in Mammalian cell. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Mouse
  • Target Protein
  • Havcr2
  • Protein Length
  • Partial (20-191aa)
  • Protein Class
  • Immune Checkpoints
  • Molecular Weight
  • 46.3 kDa
  • TMD
  • 1
  • Sequence
  • RSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIR

Product Description

  • Activity
  • Validated by ELISA
  • Expression Systems
  • Mammalian cell
  • Tag
  • C-hFc
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Endotoxin
  • <1.0 EU/μg
  • Purity
  • >95% as determined by SDS-PAGE
  • Buffer
  • 0.2 μm filtered 1xPBS, pH 7.4

Target

  • Target Protein
  • Havcr2
  • Full Name
  • Hepatitis A virus cellular receptor 2
  • Introduction
  • Cell surface receptor implicated in modulating innate and adaptive immune responses. Generally accepted to have an inhibiting function. Reports on stimulating functions suggest that the activity may be influenced by the cellular context and/or the respective ligand. Regulates macrophage activation. Inhibits T-helper type 1 lymphocyte (Th1)-mediated auto- and alloimmune responses and promotes immunological tolerance. In CD8+ cells attenuates TCR-induced signaling, specifically by blocking NF-kappaB and NFAT promoter activities resulting in the loss of IL-2 secretion. The function may implicate its association with LCK proposed to impair phosphorylation of TCR subunits. In contrast, shown to activate TCR-induced signaling in T-cells probably implicating ZAP70, LCP2, LCK and FYN. Expressed on Treg cells can inhibit Th17 cell responses.
  • Alternative Names
  • Havcr2; Tim3; Timd3; Hepatitis A virus cellular receptor 2 homolog; HAVcr-2; T-cell immunoglobulin and mucin domain-containing protein 3; TIMD-3; T-cell immunoglobulin mucin receptor 3; TIM-3; T-cell membrane protein 3; CD antigen CD366; Tim; TIM-; Timd

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us