Close
Close

Magic™ Membrane Protein Mouse Tnfrsf14 (Tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)) for Antibody Discovery (CAT#: MP1496J)

Datasheet
This product is a 45.6 kDa Mouse Tnfrsf14 membrane protein expressed in Mammalian cell. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Mouse
  • Target Protein
  • Tnfrsf14
  • Protein Length
  • Partial (39-207aa)
  • Protein Class
  • Immune Checkpoints
  • Molecular Weight
  • 45.6 kDa
  • TMD
  • 1
  • Sequence
  • QPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQV

Product Description

  • Activity
  • Validated by ELISA
  • Expression Systems
  • Mammalian cell
  • Tag
  • C-hFc
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Endotoxin
  • <1.0 EU/μg
  • Purity
  • >95% as determined by SDS-PAGE
  • Buffer
  • 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

Target

  • Target Protein
  • Tnfrsf14
  • Full Name
  • Tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)
  • Introduction
  • Receptor for four distinct ligands: The TNF superfamily members TNFSF14/LIGHT and homotrimeric LTA/lymphotoxin-alpha and the immunoglobulin superfamily members BTLA and CD160, altogether defining a complex stimulatory and inhibitory signaling network. Signals via the TRAF2-TRAF3 E3 ligase pathway to promote immune cell survival and differentiation. Participates in bidirectional cell-cell contact signaling between antigen presenting cells and lymphocytes. In response to ligation of TNFSF14/LIGHT, delivers costimulatory signals to T cells, promoting cell proliferation and effector functions. Interacts with CD160 on NK cells, enhancing IFNG production and anti-tumor immune response.
  • Alternative Names
  • A; Hv; Hve; TR2; Atar; HveA; Hvem; Tnfrs14; hvem; Tumor necrosis factor receptor superfamily member 14; Herpes virus entry mediator A; Herpesvirus entry mediator A; Tumor necrosis factor receptor-like 2; CD antigen CD270

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us