Close

Magic™ Recombinant Mouse Bnip3 Membrane Protein in Virus-Like Particles (MP-VLPs) (CAT#: S01YF-0622-KX54)

This product is recombinant Mouse Bnip3 in VLPs form. This product is produced from HEK293 by co-expressing the retroviral structural core polyprotein (gag) and the target membrane protein. MP-VLPs display highly-expressed copies of membrane proteins in their native conformation, providing an alternative to membrane protein stable cell lines, membrane preparations, detergent-solubilized proteins and other membrane protein preparation strategies. MP-VLPs can be used for a wide range of applications in antibody production, antibody discovery, antibody characterization, binding assays and functional assays.

Product Specifications

  • Host Species
  • Mouse
  • Target Protein
  • Bnip3
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • MSQSGEENLQGSWVELHFSNGNGSSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRAEIDSHSFGEKNSTLSEEDYIERRREVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSADFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF

Product Description

  • Application
  • ELISA; Antibody Production; Antibody Discovery; Antibody Characterization; Binding Assays; Functional Assays
  • Expression Systems
  • HEK293 expression system
  • Tag
  • 10xHis tag at the C-terminus
  • Protein Format
  • Membrane Protein-Virus Like Particles (MP-VLPs)
  • Buffer
  • PBS, 6% Trehalose, pH 7.4

Target

  • Target Protein
  • Bnip3
  • Full Name
  • BCL2/adenovirus E1B interacting protein 3
  • Introduction
  • Enables identical protein binding activity. Involved in several processes, including negative regulation of reactive oxygen species metabolic process; regulation of aerobic respiration; and regulation of mitochondrion organization. Acts upstream of or within several processes, including brown fat cell differentiation; intrinsic apoptotic signaling pathway; and toxin transport. Located in mitochondrial membrane and postsynaptic density. Is expressed in several structures, including central nervous system; embryo mesenchyme; gut; musculoskeletal system; and nasal epithelium. Orthologous to human BNIP3 (BCL2 interacting protein 3).
  • Alternative Names
  • Nip3; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3; BCL2/adenovirus E1B 19 kDa-interacting protein 1, NIP3; BCL2/adenovirus E1B 19kDa-interacting protein 1, NIP3; BCL2/adenovirus E1B interacting protein 1, NIP3

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us