Close

MLNR Membrane Protein Introduction

Introduction of MLNR

Motilin receptor (MLNR), a 22 amino acid peptide hormone, is encoded by the motilin receptor gene. The protein belongs to the G-protein coupled receptor 1 family, which is expressed throughout the gastrointestinal (GI) tract. This member is a multi-pass transmembrane protein and is an important therapeutic target for the treatment of hypomotility disorders. Motilin receptor mRNA is found significantly high-expressed in the duodenum and at their highest concentrations in the nerves of the antral wall of the stomach and are also found at significant levels throughout the smooth muscle of the upper gastrointestinal (GI) tract and in the enteric nervous system.

Basic Information of MLNR
Protein Name Motilin receptor
Gene Name MLNR
Aliases G-protein coupled receptor 38
Organism Homo sapiens (Human)
UniProt ID O43193
Transmembrane Times 7
Length (aa) 412
Sequence MGSPWNGSDGPEGAREPPWPALPPCDERRCSPFPLGALVPVTAVCLCLFVVGVSGNVVTVMLIG
RYRDMRTTTNLYLGSMAVSDLLILLGLPFDLYRLWRSRPWVFGPLLCRLSLYVGEGCTYATLL
MTALSVERYLAICRPLRARVLVTRRRVRALIAVLWAVALLSAGPFLFLVGVEQDPGISVVPGLN
GTARIASSPLASSPPLWLSRAPPPSPPSGPETAEAAALFSRECRPSPAQLGALRVMLWVTTAYF
FLPFLCLSILYGLIGRELWSSRRPLRGPAASGRERGHRQTVRVLLVVVLAFIICWLPFHVGRII
YINTEDSRMMYFSQYFNIVALQLFYLSASINPILYNLISKKYRAAAFKLLLARKSRPRGFHRSR
DTAGEVAGDTGGDTVGYTETSANVKTMG

Function of MLNR Membrane Protein

Motilin Receptors are Gq/11-protein-coupled receptors that mediate progastrokinetic effects. Motilin receptors promote gastric emptying after food intake and increase smooth muscle contraction in the GI tract. Motilin receptors have not been identified in rodents, but have been cloned in rabbits and humans. The phase III contractions are induced by motilin as a hunger signal and occur as part of the migrating motor complex (MMC), a contractility pattern of the gastrointestinal tract during fasting. However, the mechanism involved in this association between subjective hunger feelings and gastrointestinal motility during the MMC and its ability to stimulate food intake are largely unknown.

MLNR Membrane Protein IntroductionFig.1 Structure of MLNR membrane protein.

Application of MLNR Membrane Protein in Literature

  1. Deloose E., et al. Effect of motilin receptor activation on food intake and food timing. Am J Clin Nutr. 2018, 107(4):537-543. PubMed ID: 29635488.

    This article reports that motilin receptor stimulation during the fasting state does not affect total caloric intake nor does endogenous motilin stimulate meal requests after breakfast in the current study population.

  2. Deloose E., et al. The motilin receptor agonist erythromycin stimulates hunger and food intake through a cholinergic pathway. Am J Clin Nutr. 2016, 103(3):730-7. PubMed ID: 26817505

    This article reveals that reduced expression of MLNR is possibly related to that vascular permeability in the hind plantar skin of rats decreases following lumbar sympathectomy.

  3. Sanger G.J. Ghrelin and motilin receptor agonists: time to introduce bias into drug design. Neurogastroenterol Motil. 2014, 26(2):149-55. PubMed ID: 24438586

    This article uncovers five non-orthosteric sites on the MLNR which are potential for the treatment of inflammatory and neurological diseases, through applying the fragment-based mapping algorithm, FTMap, on the conformations of MLNR.

  4. Dennie J., et al. A Phase 1 Study to Assess the Safety, Tolerability, Pharmacokinetics, and Pharmacodynamics of Single Oral Doses of DS-3801b, a Motilin Receptor Agonist, in Healthy Subjects. J Clin Pharmacol. 2017, 57(9):1221-1230. PubMed ID: 28464321

    This article assesses the safety, tolerability, pharmacokinetics, and pharmacodynamic effects on proximal and distal gastrointestinal (GI) motility of single oral doses of a Motilin Receptor Agonist DS-3801b in healthy subjects.

  5. Sanger G.J., et al. Motilin: towards a new understanding of the gastrointestinal neuropharmacology and therapeutic use of motilin receptor agonists. Am J Transl Res. 2016, 8(5), 2210-21. PubMed ID: 27347328

    Dependent on structural information and on animal studies, this article focuses on the study of motilin and demonstrates the need to avoid overreliance on artificial systems.

MLNR Preparation Options

To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-MLNR antibody development services.


Equipped with world-leading technology platforms and professional scientific staff, Creative Biolabs has successfully generated a variety of functional membrane protein targets for our customers. We are pleased to tailor one-stop, custom-oriented service packages and provide lyophilization or freezing service for long-term storage of membrane proteins from weeks to months. Please feel free to contact us for more information.


All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us