Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsThe membrane magnesium transporter 1 (MMGT1) in humans is encoded by the MMGT1 gene. MMGT1 belongs to the magnesium transporter1 (MagT1) family which is a group of magnesium transporters that are part of the TOG superfamily. MMGT1 is described as having 335 amino acids and five TMSs with an N-terminal cleavage site and a number of phosphorylation sites.
| Basic Information of MMGT1 | |
| Protein Name | Membrane magnesium transporter 1 |
| Gene Name | MMGT1 |
| Aliases | EMC5, TMEM32 |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q8N4V1 |
| Transmembrane Times | 2 |
| Length (aa) | 131 |
| Sequence | MAPSLWKGLVGIGLFALAHAAFSAAQHRSYMRLTEKEDESLPIDIVLQTLLAFAVTCYGIVHIAGEFKDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDTANSSNQDALSSNTSLKLRKLESLRR |
Membrane magnesium transporters are proteins that transport magnesium across cell membranes and are ubiquitously expressed in all human tissues. Magnesium is required for all forms of life. Knocking out the MMGT1 protein reduces the concentration of Mg2+ in mammalian cell lines and leads to early developmental arrest. MMGT1 also mediates saturable Mg2+ uptake with a Km of 0.23 mM. Furthermore, the transport of MMGT1 to Mg2+ is chilled, voltage-dependent, and shows no time-dependent inactivation, presumably MagT1 has an N-terminal thioredoxin domain of unknown function. In addition, the ATPase function of MMGT1 is highly dependent on cardiolipin and has been shown to detect free magnesium in the μM range. However, the molecular mechanism of uptake of Mg2+ from the environment and the function of the Mg2+ transporter is not clear.
Fig.1 Structure of MgtE Mg2+ channel. (Moomaw, 2008)
This review focuses on magnesium transporter 1 (MAGT1), which identifies genetic alterations and their functional consequences in immunodeficient patients, suggesting that magnesium and MAGT1 are key molecular players in T cell-mediated immune responses.
The article reviews the results of magnesium homeostasis research and discusses their potential impact on disease treatment, which is the key to understanding the relevant pathophysiological conditions and their treatment.
This review describes recent hypothetical findings regarding novel magnesium transporters in renal transport epithelial cells, which may be the key to supplementing current knowledge about magnesium treatment in the kidneys.
The article shows that MagT1 and TUSC3 are indispensable members of the Mg2+ transport system of the spinal motor membrane. Two mammalian genes, MagT1 and TUSC3, are identified by yeast complementary screening, which are the main mechanisms of Mg2+ influx.
The article shows that MMGT regulates the transport of Mg2+ in Golgi derived from epithelial cells via identifying the expression of MMgT1 and MMgT2 mRNA in the renal cortex of mice and the expression of MMgT1 and MMgT2 in Golgi and Golgi posterior vesicles.
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Besides, we also provide customized anti-MMGT1 antibody development services based on our versatile Magic™ anti-membrane protein antibody discovery platform.
Creative Biolabs' skillful scientists are glad to leverage our expertise and advanced technologies to help you with the member protein research. If you are interested, please feel free to contact us for more details.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
