Introduction of MRGPRD
MRGPRD (MAS Related GPR Family Member D) belongs to a subfamily of G protein-coupled receptors (GPCRs) related to the MAS1 oncogene, including MRGD. MRGPRDs in humans, encoded by MRGPRD gene, are 7-transmembrane G-linked receptor proteins, possessing G-protein coupled receptor activity. The expression of a subset of MRGs was found predominantly in primary specific classes of sensory neurons and mast cells. As a novel GPCR family, MRGPR family consists of ∼40 members, which are classified into nine distinct subfamilies (MRGPRA to -H and -X).
| Basic Information of MRGPRD | |
| Protein Name | Mas-related G-protein coupled receptor member D |
| Gene Name | MRGPRD |
| Aliases | Beta-alanine receptor, G-protein coupled receptor TGR7 |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q8TDS7 |
| Transmembrane Times | 7 |
| Length (aa) | 321 |
| Sequence | MNQTLNSSGTVESALNYSRGSTVHTAYLVLSSLAMFTCLCGMAGNSMVIWLLGFRMHRNPFCIYILNLAAADLLFLFSMASTLSLETQPLVNTTDKVHELMKRLMYFAYTVGLSLLTAISTQRCLSVLFPIWFKCHRPRHLSAWVCGLLWTLCLLMNGLTSSFCSKFLKFNEDRCFRVDMVQAALIMGVLTPVMTLSSLTLFVWVRRSSQQWRRQPTRLFVVVLASVLVFLICSLPLSIYWFVLYWLSLPPEMQVLCFSLSRLSSSVSSSANPVIYFLVGSRRSHRLPTRSLGTVLQQALREEPELEGGETPTVGTNEMGA |
Function of MRGPRD Membrane Protein
In rodents, a core set of approximately four different genes (MrgA, MrgB, MrgC, and MrgD) contributes to Mrg sequence diversity, which defines a similar number of neuronal cell populations. Comparisons between mouse and human genomic may reveal differences atypical of rodents sometimes. Related researches have shown that MRGPR subtypes play an important role in nociception, pruritus, sleep, cell proliferation, circulation, and mast cell degranulation. MRGPRD protein may play a role in the regulation of nociceptor function and/or development, including the sensation or modulation of pain. MRGPRD acts as a specific membrane receptor for beta-alanine. It has been suggested that polymodal nociceptive neurons expressed MRGPRD and innervated mostly subpopulations of substantia gelatinosa neurons.
Fig.1 Schematic shows physiologic effects for MRGPRD in primary sensory DRG/ trigeminal ganglia (TG) neurons and blood vessels. (Solinski, 2014)
Application of MRGPRD Membrane Protein in Literature
This article expands the molecular characterization of C-LTMRs by using a genetically marking C-LTMRs and MRGPRD+ neurons mouse model.
This article reveals that the hyperexcitability of MRGPRA3+ and MRGPRD+ neurons may contribute to the spontaneous itch- and pain-related behaviors accompanying contact hypersensitivity and/or other inflammatory diseases in humans.
This article confirms that MRGPRD mRNA is co-expressed in the small diameter neurons with P2X3 and VR1, both in rat and monkey dorsal root ganglia. Additionally, the report shows that MRGPRD plays a role in the modulation of neuropathic pain.
This article suggests more generally that mouse-human genomic comparisons may sometimes reveal differences atypical of rodents.
This article identifies novel G protein-coupled receptors (GPCRs) with no introns in the coding region from the human genome sequence.
MRGPRD Preparation Options
To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-MRGPRD antibody development services.
Creative Biolabs is equipped with world-leading technology platforms and professional scientific staff. We have successfully generated a variety of functional membrane protein targets for our worldwide customers. We are pleasant to tailor one-stop, custom-oriented service packages and provide lyophilization or freezing service for long-term storage of membrane proteins from weeks to months. Please feel free to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.