Close

NPBWR1 Membrane Protein Introduction

Introduction of NPBWR1

Encoded by NPBWR1 gene which is located on chromosome 10q11.2-121.1 in human, neuropeptide B/W receptor-1 (NPBWR1) has been known as orphan receptor GPR7. In human and rodents, the NPBWR1 gene is mainly localized within the central nervous system (CNS), including the hippocampus, hypothalamus, subcortical limbic telencephalon, olfactory cortex, and tegmental area, suggesting that the NPBWR1 receptor is involved in cardiovascular and neuroendocrine responses, homeostasis regulation, reward system, as well as locomotor activity.

Basic Information of NPBWR1
Protein Name Neuropeptides B/W receptor type 1
Gene Name NPBWR1
Aliases GPR7
Organism Homo sapiens (Human)
UniProt ID NPBWR1
Transmembrane Times 7
Length (aa) 328
Sequence MDNASFSEPWPANASGPDPALSCSNASTLAPLPAPLAVAVPVVYAVICAVGLAGNSAVLYVLLRAPRMKTVTNLFILNLAIADELFTLVLPINIADFLLRQWPFGELMCKLIVAIDQYNTFSSLYFLTVMSADRYLVVLATAESRRVAGRTYSAARAVSLAVWGIVTLVVLPFAVFARLDDEQGRRQCVLVFPQPEAFWWRASRLYTLVLGFAIPVSTICVLYTTLLCRLHAMRLDSHAKALERAKKRVTFLVVAILAVCLLCWTPYHLSTVVALTTDLPQTPLVIAISYFITSLSYANSCLNPFLYAFLDASFRRNLRQLITCRAAA

Function of NPBWR1 Membrane Protein

Neuropeptide B (NPB) and neuropeptide W (NPW) are two endogenous peptide ligands of NPBWR1 which were identified in 2003. Due to the pharmacological effects of NPB and NPW, NPBWR1 has been served as a potential new therapeutic target. In recent years, a series of researches have suggested NPBWR1 to be involved in neuroendocrine function, energy homeostasis, feeding behavior, and modulating inflammatory pain. In addition, NPBWR1 is a novel anti-obesity target, and scientists are trying to develop an antagonist as the pharmacological tool. The neuropathic pain induced by acute inflammatory and trauma increases the myelin-associated expression of NPBWR1, suggesting its powerful role in analgesia. Moreover, the seizure activity reduced by the administration of NPW in the brain, suggesting that NPWR1 might be the potential target for epilepsy.

Structure of NPB/W and their receptors. Fig.1 Structure of NPB/W and their receptors.

Application of NPBWR1 Membrane Protein in Literature

  1. Guerrero M., et al. SAR analysis of novel non-peptidic NPBWR1 (GPR7) antagonists. Bioorganic & Medicinal Chemistry Letters. 2013, 23(3): 614-619. PubMed ID: 23287738

    Authors in this group apply the innovative nonpeptidic selective NPBWR1 antagonists to clarify the biological roles and therapeutic utility of the target receptor.

  2. Sakurai T. NPBWR1 and NPBWR2: Implications in Energy Homeostasis, Pain, and Emotion. Frontiers in Endocrinology. 2013, 4: 23. PubMed ID: 23515889

    This article focuses on the study of neuropeptide B/W receptor-1 (NPBWR1) and NPBWR2. According to both pharmacological and phenotypic analyses with engineered mice as well as human, the potential roles of NPBWR1 and NPBWR2 have been discovered in regulating stress responses.

  3. Romero F.A., et al. The discovery of potent antagonists of NPBWR1 (GPR7). Bioorganic & Medicinal Chemistry Letters. 2012, 22(2): 1014-1018. PubMed ID: 22197390

    This article firstly reports the synthesis and evaluation of small molecule antagonists of NPBWR1 (GPR7), which can be served as a novel anti-obesity target.

  4. Urbano M., et al. Design, synthesis and SAR analysis of novel potent and selective small molecule antagonists of NPBWR1 (GPR7). Bioorganic & Medicinal Chemistry Letters. 2012, 22(23): 7135-7141. PubMed ID: 23079522

    This article reveals the novel small molecule antagonists of NPBWR1 and its molecular basis of the in vivo physiological function and therapeutic utility.

NPBWR1 Preparation Options

In order to obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-NPBWR1 antibody development services.


As a leading custom service provider in the field of the membrane protein, Creative Biolabs is pleased to use our advanced platform and extensive experience to provide the most qualified products and the best services to satisfy each demand from our clients. If you are interested in our membrane protein services, please feel free to contact us for more information.


All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us