Introduction of NPBWR1
Encoded by NPBWR1 gene which is located on chromosome 10q11.2-121.1 in human, neuropeptide B/W receptor-1 (NPBWR1) has been known as orphan receptor GPR7. In human and rodents, the NPBWR1 gene is mainly localized within the central nervous system (CNS), including the hippocampus, hypothalamus, subcortical limbic telencephalon, olfactory cortex, and tegmental area, suggesting that the NPBWR1 receptor is involved in cardiovascular and neuroendocrine responses, homeostasis regulation, reward system, as well as locomotor activity.
| Basic Information of NPBWR1 | |
| Protein Name | Neuropeptides B/W receptor type 1 |
| Gene Name | NPBWR1 |
| Aliases | GPR7 |
| Organism | Homo sapiens (Human) |
| UniProt ID | NPBWR1 |
| Transmembrane Times | 7 |
| Length (aa) | 328 |
| Sequence | MDNASFSEPWPANASGPDPALSCSNASTLAPLPAPLAVAVPVVYAVICAVGLAGNSAVLYVLLRAPRMKTVTNLFILNLAIADELFTLVLPINIADFLLRQWPFGELMCKLIVAIDQYNTFSSLYFLTVMSADRYLVVLATAESRRVAGRTYSAARAVSLAVWGIVTLVVLPFAVFARLDDEQGRRQCVLVFPQPEAFWWRASRLYTLVLGFAIPVSTICVLYTTLLCRLHAMRLDSHAKALERAKKRVTFLVVAILAVCLLCWTPYHLSTVVALTTDLPQTPLVIAISYFITSLSYANSCLNPFLYAFLDASFRRNLRQLITCRAAA |
Function of NPBWR1 Membrane Protein
Neuropeptide B (NPB) and neuropeptide W (NPW) are two endogenous peptide ligands of NPBWR1 which were identified in 2003. Due to the pharmacological effects of NPB and NPW, NPBWR1 has been served as a potential new therapeutic target. In recent years, a series of researches have suggested NPBWR1 to be involved in neuroendocrine function, energy homeostasis, feeding behavior, and modulating inflammatory pain. In addition, NPBWR1 is a novel anti-obesity target, and scientists are trying to develop an antagonist as the pharmacological tool. The neuropathic pain induced by acute inflammatory and trauma increases the myelin-associated expression of NPBWR1, suggesting its powerful role in analgesia. Moreover, the seizure activity reduced by the administration of NPW in the brain, suggesting that NPWR1 might be the potential target for epilepsy.
Fig.1 Structure of NPB/W and their receptors.
Application of NPBWR1 Membrane Protein in Literature
Authors in this group apply the innovative nonpeptidic selective NPBWR1 antagonists to clarify the biological roles and therapeutic utility of the target receptor.
This article focuses on the study of neuropeptide B/W receptor-1 (NPBWR1) and NPBWR2. According to both pharmacological and phenotypic analyses with engineered mice as well as human, the potential roles of NPBWR1 and NPBWR2 have been discovered in regulating stress responses.
This article firstly reports the synthesis and evaluation of small molecule antagonists of NPBWR1 (GPR7), which can be served as a novel anti-obesity target.
This article reveals the novel small molecule antagonists of NPBWR1 and its molecular basis of the in vivo physiological function and therapeutic utility.
NPBWR1 Preparation Options
In order to obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-NPBWR1 antibody development services.
As a leading custom service provider in the field of the membrane protein, Creative Biolabs is pleased to use our advanced platform and extensive experience to provide the most qualified products and the best services to satisfy each demand from our clients. If you are interested in our membrane protein services, please feel free to contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.