Introduction of P2RX7
The P2RX7 receptor is a member of the family of extracellular ATP (eATP)-gated ion channels expressed in immune cells, where its activation triggers the inflammatory cascade. Therefore, P2RX7 has been long investigated as a target in the treatment of infectious and inflammatory diseases. Subsequently, P2RX7 signaling has been documented in other physiological and pathological processes including pain, CNS and psychiatric disorders and cancers. Notably, targeted inhibition of P2RX7 is crucial as its global blockade reduces the immune and inflammatory responses, which has important anti-tumor effects in some types of malignancies. P2RX7 comprises intracellular N and C termini, two transmembrane domains and a large intervening extracellular region containing the ATP binding site.
| Basic Information of P2RX7 | |
| Protein Name | P2X purinoceptor 7 |
| Gene Name | P2RX7 |
| Aliases | P2X7, ATP receptor, P2Z receptor, Purinergic receptor |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q99572 |
| Transmembrane Times | 0 |
| Length (aa) | 595 |
| Sequence | MPACCSCSDVFQYETNKVTRIQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISSVHTKVKGIAEVKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCPEYPTRRTLCSSDRGCKKGWMDPQSKGIQTGRCVVYEGNQKTCEVSAWCPIEAVEEAPRPALLNSAENFTVLIKNNIDFPGHNYTTRNILPGLNITCTFHKTQNPQCPIFRLGDIFRETGDNFSDVAIQGGIMGIEIYWDCNLDRWFHHCRPKYSFRRLDDKTTNVSLYPGYNFRYAKYYKENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLAAVFIDFLIDTYSSNCCRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRSLQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCGSCLPSQLPESHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDSTNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYSGFKSPY |
Function of P2RX7 Membrane Protein
Belonging to the ionotropic purinergic P2X subfamily, P2RX7 is trimeric ligand-gated ion channel displaying a preference for cations and is responsible for the eATP-dependent lysis of macrophages. P2RX7 is to be expressed on macrophages and microglia with high levels, suggesting its role in regulating innate and adaptive immune responses. In addition, various researches have demonstrated that P2RX7 has a huge functional repertoire such as inflammation, proliferation, migration and invasion, metabolism, autophagy, cell death, and neurotransmission. P2RX7 over-expression and over-activation have been implicated in numerous physiological/pathophysiological processes. Specifically, P2RX7 regulates the immune response either directly or via Toll-like receptors (TLRs), and it has been reported that TLR2 and TLR4 can directly interact with P2RX7 via biglycan. Once activated by ATP, P2RX7 can trigger the TLR4-mediated pro-IL-1β processing followed by potassium efflux, NLRP3/ASC inflammasome assembly, and caspase-1-dependent IL-1β maturation and release. Besides, nearly all tumor types are found to have upregulated P2RX7 expression, highlighting the significant potential for novel therapeutic approaches.
Fig.1 Recent P2RX7 structural developments: the ATP binding pocket and the allosteric groove. (Young, 2018)
Application of P2RX7 Membrane Protein in Literature
In this article, the authors show that activation of P2RX7 by eATP can alert the nervous and immune system to tissue damage, and promote the metabolic fitness and survival of the most durable and functionally relevant memory CD8+ T cell populations.
This article indicates that Tet1 and Tet2 play a critical role in maintaining bone marrow mesenchymal stem cells (BMMSC) and bone homeostasis through demethylation of P2rX7 to control exosome and miRNA release, suggesting that Tet/P2rX7/Runx2 cascade may serve as a target for the development of novel therapies for osteopenic disorders.
This report suggests that icariin has a significant role in promoting the recovery of chicken growth plates affected by Tibial dyschondroplasia (TD) via regulating the P2RX7, revealing a new target for clinical treatment and prevention of TD in broiler chickens.
This article suggests that P2RX7 may play an important role in the regulation of autophagy by the fine-tuning of HSPB1 expression.
This report reveals that AZT (Zidovudine) could inhibit P2RX7 functions, suggesting its potential role in the treatment of Duchenne muscular dystrophy (DMD). And it is not constrained by causative DMD mutations and may be effective in alleviating both muscle and non-muscle abnormalities.
P2RX7 Preparation Options
We provide custom membrane protein preparation services for worldwide customers. Leveraging by our advanced MemDX™ membrane protein production platform, we are able to present target membrane protein in multiple active formats. Our professional scientists are happy to help you find an ideal method and make your project a success. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-P2RX7 antibody development services.
Creative Biolabs provides high-quality membrane protein preparation service to facilitate the development of worldwide customer’s research. During the past years, we have successfully established a powerful MemDX™ membrane protein platform which enables us to provide a series of membrane protein preparation services. For more detailed information, please feel free to contact us.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.