Close

P2RY8 Membrane Protein Introduction

Introduction of P2RY8

P2RY8 is encoded by the P2RY8 gene. It belongs to the G-protein-coupled receptor (GPCR) family which is the largest family of membrane-bound receptors and also the targets of many drugs. It is one of the nigh subtypes of purinergic receptors (P2RY1, P2RY2, P2RY4, P2RY6, P2RY8, P2RY11, P2RY12, P2RY13, and P2RY14). P2RY8 possesses seven transmembrane alpha helices as other GPCRs and is activated by adenosine and uridine nucleotides. However, the expression profile of P2RY8 has been rarely documented in humans.

Basic Information of P2RY8
Protein Name P2Y purinoceptor 8
Gene Name P2RY8
Aliases NA
Organism Homo sapiens (Human)
UniProt ID Q86VZ1
Transmembrane Times 7
Length (aa) 359
Sequence MQVPNSTGPDNATLQMLRNPAIAVALPVVYSLVAAVSIPGNLFSLWVLCRRMGPRSPSVIFMINLSVTDL
MLASVLPFQIYYHCNRHHWVFGVLLCNVVTVAFYANMYSSILTMTCISVERFLGVLYPLSSKRWRRRRYA
VAACAGTWLLLLTALSPLARTDLTYPVHALGIITCFDVLKWTMLPSVAMWAVFLFTIFILLFLIPFVITV
ACYTATILKLLRTEEAHGREQRRRAVGLAAVVLLAFVTCFAPNNFVLLAHIVSRLFYGKSYYHVYKLTLC
LSCLNNCLDPFVYYFASREFQLRLREYLGCRRVPRDTLDTRRESLFSARTTSVRSEAGAHPEGMEGATRP
GLQRQESVF

Function of P2RY8 Membrane Protein

P2RY8 functions as a transmembrane receptor, which preferentially binds to, and is activated by, adenosine and uridine nucleotides. The activity of P2RY8 is activated by adenosine and uridine nucleotides resulting in evoking the activation of adenylyl cyclase intracellular signaling pathway. Upon binding to nucleotides, P2RY8 can activate the extracellular signal-regulated kinases signaling pathway and the activation of phospholipase C. There are also some research papers show that the purinergic receptor signaling is involved in a variety of cellular responses, such as cell differentiation, cell migration, cell growth, and cell apoptosis. When it comes to screen the downstream components of P2RY8 signaling pathway in cells, the CREB and Elk-1 are activated by P2RY8, and the expression level of P2RY8 is upregulated after activation. Meanwhile, the transcriptional activities of the SRE, the c-Fos and c-Myc are regulated by P2RY8. The patients with a high expression level of P2RY8 have a higher risk of leukemogenesis than those with a lower expression level of P2RY8, so P2RY8 may have a contribution to leukemogenesis.

Schematic overview of the various mechanisms of P2RY membrane proteins. Fig.1 Schematic overview of the various mechanisms of P2RY membrane proteins. (Hechler, 2015).

Application of P2RY8 Membrane Protein in Literature

  1. Fujiwara S-I., et al. Transforming activity of purinergic receptor P2Y, G protein coupled, 8 revealed by retroviral expression screening. Leuk Lymphoma. 2007, 48(5):978-986. PubMed ID: 17487742

    This article reports that P2RY8 has a possible contribution to the formation of leukemogenesis because of the higher expression level of P2RY8 in leukemia patients. P2RY8 may be a potential drug target for the treatment of leukemia.

  2. Dou H., et al. Prognostic significance of P2RY8-CRLF2 and CRLF2 overexpression may vary across risk subgroups of childhood B-cell acute lymphoblastic leukemia. Genes Chromosomes Cancer. 2016, 56(2):135-146. PubMed ID: 27637012

    This article reveals that P2RY8-CRLF2 fusion protein is an important indicator to the B-cell acute lymphoblastic leukemia because the expression pattern of P2RY8-CRLF2 fusion protein is correlated with the occurrence rate of B-cell acute lymphoblastic leukemia.

  3. Morak M., et al. Small sizes and indolent evolutionary dynamics challenge the potential role of P2RY8-CRLF2–harboring clones as main relapse-driving force in childhood ALL. Blood. 2012, 120(26):5134-5142. PubMed ID: 23091296

    Authors in this group apply the genomic quantification method to analyze the P2RY8-CRLF2 positive leukemias, and the expression of P2RY8-CRLF2 fusion protein increases in B-cell precursor acute lymphoblastic leukemia patients.

  4. Palmi C., et al. Poor prognosis for P2RY8-CRLF2 fusion but not for CRLF2 over-expression in children with intermediate risk B-cell precursor acute lymphoblastic leukemia. Leukemia. 2012, 26:2245. PubMed ID: 22484421

    This article focuses on the pharmacological role of P2RY8-CRLF2 fusion protein in pediatric B-cell precursor acute lymphoblastic leukemia and suggests that P2RY8-CRLF2 fusion protein is the most relevant prognostic factor in CRLF2 overexpression pediatric B-cell precursor acute lymphoblastic leukemia patients.

  5. Storlazzi C.T., et al. Upregulation of the SOX5 by promoter swapping with the P2RY8 gene in primary splenic follicular lymphoma. Leukemia. 2007, 21:2221. PubMed ID: 17554380

    This article evaluates the overexpression of SOX5 is regulated by the P2RY8 promoter and the further studies indicate that SOX5 gene expression may be involved in the pathogenesis of primary splenic follicular lymphoma.

P2RY8 Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-P2RY8 antibody development services.


Creative Biolabs has been at the forefront of functional membrane proteins research for many years, we have won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects in the field of membrane protein, Please feel free to contact us for more information.

Reference

  1. Hechler B & Gachet C. (2015). Purinergic Receptors in Thrombosis and Inflammation. Atertio. Thromb. Vasc. Biol. 35(11):2307-2317.

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

45-1 Ramsey Road, Shirley, NY 11967, USA
Call us at:
USA: 1-631-381-2994
Europe: 44-207-097-1828
Fax: 1-631-207-8356
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us