Close

PDPN Membrane Protein Introduction

Introduction of PDPN

Podoplanin (PDPN), encoded by human PDPN gene, is a 38-40 kDa type I mucin-like transmembrane glycoprotein belonging to the podoplanin family. The structure of PDPN is characterized by a heavily glycosylated amino-terminal extracellular domain of approximately 130 amino acids, followed by a single transmembrane domain of approximately 25 amino acids, and a short intracellular domain of approximately 10 amino acids. PDPN has been found to be expressed in numerous human issues, such as the kidney, skeletal muscles, heart, placenta, and lung. Because of the exclusive expression in the lymphatic endothelial cells (LEC), PDPN has been regarded as a useful marker for lymphatic endothelium and lymphangiogenesis.

Basic Information of PDPN
Protein Name Podoplanin
Gene Name PDPN
Aliases Aggrus, Glycoprotein 36, Gp36, PA2.26 antigen, T1-alpha, T1A, Cleaved into: 29kDa cytosolic podoplanin intracellular, PICD
Organism Homo sapiens (Human)
UniProt ID Q86YL7
Transmembrane Times 1
Length (aa) 162
Sequence MWKVSALLFVLGSASLWVLAEGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVMRKMSGRYSP

Function of PDPN Membrane Protein

Except for the role as a specific marker of lymphatic endothelium, PDPN is widely reported as an effective biomarker and therapeutic target of various cancers. Recent studies show that PDPN expression is upregulated in various human tumors, including colorectal tumors, squamous cell carcinomas, mesothelioma, testicular seminoma, brain tumors and some types of vascular tumors as well as in some papillary thyroid tumors, suggesting the promising as a useful biomarker of cancer. Though PDPN does not contain known functional domains or enzymatic activities, it exerts the regulatory function via interacting with other ligands and binding partners, such as HSPA9, CD44, C-type lectin-like receptor-2 (CLEC-2), protein kinase A (PKA), cyclin-dependent kinase 5 (CDK5), etc. to control tumor cell migration, invasion and metastasis. Moreover, high levels of PDPN expression is associated with reduced survival and cancer aggression. In addition, PDPN is required to protect the barrier function of high endothelial venules (HEVs) during lymphocyte trafficking.

PDPN Membrane Protein Introduction Fig.1 Podoplanin (PDPN) structure and targeting agents. (Krishnan, 2018)

Application of PDPN Membrane Protein in Literature

  1. Yamada S., et al. Epitope mapping of anti-mouse podoplanin monoclonal antibody PMab-1. Biochem Biophys Rep. 2018, 15: 52-56. PubMed ID: 29998193

    The authors in this article use flow cytometry, enzyme-linked immunosorbent assay, and immunohistochemical analyses to identify that the critical epitope of PMab-1 is Asp39 and Met41 of mPDPN, which can be applied to the production of more functional anti-mPDPN monoclonal antibodies.

  2. Xie C., et al. Preparation of Anti-Human Podoplanin Monoclonal Antibody and its application in Immunohistochemical Diagnosis. Sci Rep. 2018, 8(1): 10162. PubMed ID: 29976954

    This article provides conclusive guidelines for the preparation of mAbs of Podoplanin and their applications in immunohistochemistry diagnosis.

  3. Xie L., et al. Elevated expression of podoplanin and its clinicopathological, prognostic, and therapeutic values in squamous non-small cell lung cancer. Cancer Manag Res. 2018, 10: 1329-1340. PubMed ID: 29872344

    This article demonstrates a distinctively elevated expression of PDPN in squamous non-small cell lung cancer (SqNSCLC), which is significantly associated with worse clinicopathological features and poorer prognosis, indicating the potential of anti-PDPN targeted therapy for future SqNSCLC treatment.

  4. Bond S.R., et al. Pannexin 3 is required for late stage bone growth but not for initiation of ossification in avian embryos. Dev Dyn. 2016, 245(9): 913-24. PubMed ID: 27295565

    This article demonstrates PANX3 hemichannels may be required to facilitate the transition of hypertrophic chondrocytes to osteoblasts, thereby achieving final bone size.

  5. Suzuki-Inoue K. Roles of the CLEC-2-podoplanin interaction in tumor progression. Platelets. 2018, 4: 1-7. PubMed ID: 29863945

    This article indicates that anti-podoplanin and anti-CLEC-2 drugs are promising therapies for the prevention of tumor metastasis, progression, and tumor-related symptoms, which may result in longer survival in cancer patients.

PDPN Preparation Options

We provide custom membrane protein preparation services for worldwide customers. Leveraging by our advanced Magic™ membrane protein production platform, we are able to present target membrane protein in multiple active formats. Our professional scientists are happy to help you find an ideal method and make your project a success. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-PDPN antibody development services.


Creative Biolabs provides high-quality membrane protein preparation service to facilitate the development of worldwide customer’s research. During the past years, we have successfully established a powerful Magic™ membrane protein platform which enables us to provide a series of membrane protein preparation services. For more detailed information, please feel free to contact us.

Reference

  1. Krishnan H, et al. (2018). Podoplanin: An emerging cancer biomarker and therapeutic target. Cancer Sci. 109: 1292-1299.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us