Close

PLLP Membrane Protein Introduction

Introduction of PLLP

Plasmolipin is a protein encoded by the PLLP gene in humans. The PLLP is localized and recycled between the serosa and the Golgi. In the Golgi apparatus, PLLP forms an oligomer based on fluorescence resonance energy transfer (annoyance) analysis. Golgi entering the plasma membrane transport of the secreted protein vesicular stomatitis virus G protein (VSVG), rather than a VSVG mutant with an elongated transmembrane domain is stopped by PLLP. Laurdan staining analysis indicated that the block was associated with pllp-induced proliferation of the membrane.

Basic Information of PLLP
Protein Name Plasmolipin
Gene Name PLLP
Aliases Plasma membrane proteolipid
Organism Homo sapiens (Human)
UniProt ID Q9Y342
Transmembrane Times 4
Length (aa) 182
Sequence MAEFPSKVSTRTSSPAQGAEASVSALRPDLGFVRSRLGALMLLQLVLGLLVWALIADTPYHLYPAYGWVMFVAVFLWLVTIVLFNLYLFQLHMKLYMVPWPLVLMIFNISATVLYITAFIACSAAVDLTSLRGTRPYNQRAAASFFACLVMIAYGVSAFFSYQAWRGVGSNAATSQMAGGYA

Function of PLLP Membrane Protein

Plasmolipin (PLLP) contains a protein-related flux in the vesicle-associated domain and is highly expressed in the brain associated with myelin-associated regions, but also in the apical region of epithelial cells. Myelin constitutes a compact stack of large surface areas, a protein-poor thick film that isolates axons to allow for rapid signal transmission. The increase in PLLP is involved in postpartum myelination, but its function remains unknown. In the primary glial and cultured cells, fluorescently labeled PLLP and antibodies were used against PLLP, and their intracellular localization and kinetic properties were significant. Previous studies have shown that in the Golgi apparatus, PLLP aggregates potential myelin membrane precursor domains through its oligomerization and liquid-attracting lipids. These data support a model in which PLLP acts as a myelin through the tissue myelin lining membrane.

PLLP Membrane Protein IntroductionFig.1 The structure of Plasmolipin.

Application of PLLP Membrane Protein in Literature

  1. Le Guelte A., Macara IG. Plasmolipin-a new player in endocytosis and epithelial development. The EMBO Journal. 2015, 34(9):1147-1148. PubMed ID: 25825384

    The authors identified a new participant, a protein that was previously uncharacteristically called Plasmolipin. Not only did they report the mechanism of action through binding to epsin, but they also emphasized the important role of Notch signaling in controlling epithelial cell differentiation.

  2. Miller A. D., et al. Identification of the Myelin Protein Plasmolipin as the Cell Entry Receptor for Mus Caroli Endogenous Retrovirus. Journal of Virology. 2008, 82 (14): 6862-6868. PubMed ID: 18463156

    These results indicate that PLLP is an effective receptor for McERV.

  3. Chen Z., et al. Collapsin Response Mediator Protein 4 Promotor Methylation Level as a Potential Predictor for Diagnosing Primary Malignant Lymphoma of the Prostate. Cancer Cell International. 2018, (18): 3. PubMed ID: 29308052

    These results indicate that methylation of the CRMP4 gene in PLLP is significantly increased, suggesting its potential of being a new predictor of PLLP.

  4. Rodríguez-Fraticelli A.E, et al. Developmental Regulation of Apical Endocytosis Controls Epithelial Patterning in Vertebrate Tubular Organs. Nature cell biology. 2015,17 (3): 241-250. PubMed ID: 25706235

    These results show that PLLP expression induces apical debris (Crb) internalization and activation of the Notch signaling pathway, both of which are key steps in obtaining cell polarity and epithelial cell differentiation.

  5. Yaffe Y., et al. The myelin proteolipid plasmolipin, forms oligomers and induces liquid ordered membranes in the Golgi apparatus. Journal of Cell Science. 2015, 128(13):2293-302.PubMed ID: 26002055

    These data support a model in which PLLP exerts myelin action through the tissue myelin liquid membrane.

PLLP Preparation Options

To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Besides, aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-PLLP antibody development services.


Creative Biolabs' skillful scientists are glad to leverage our expertise and advanced technologies to help you with the member protein research. If you are interested, please feel free to contact us for more details.


All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us