Close

PROKR2 Membrane Protein Introduction

Introduction of PROKR2

PROKR2 is encoded by the PROKR2 gene. It belongs to the G-protein-coupled receptor (GPCR) family which is the largest single class trans-membrane proteins and is important regulator therapeutic drug targets of human physiology. It is one of the two subtypes of family A GPCRs (PROK1 and PROKR2). Amino acids sequence indicates that PROKR1 and PROKR2 share 85% sequence identity. PROKR2 is composed of 81 amino acids contains 10 cysteines forming five disulfide bridges. No structure of the PROKR1 or PROKR2 has been reported so far.

Basic Information of PROK2
Protein Name Prokineticin receptor 2
Gene Name PROKR2
Aliases G-protein coupled receptor 73-like 1, G-protein coupled receptor I5E, GPR73b,
GPRg2
Organism Homo sapiens (Human)
UniProt ID Q8NFJ6
Transmembrane Times 7
Length (aa) 384
Sequence MAAQNGNTSFTPNFNPPQDHASSLSFNFSYGDYDLPMDEDEDMTKTRTFFAAKIV
IGIALAGIMLVCGIGNFVFIAALTRYKKLRNLTNLLIANLAISDFLVAIICCPFE
MDYYVVRQLSWEHGHVLCASVNYLRTVSLYVSTNALLAIAIDRYLAIVHPLKPRM
NYQTASFLIALVWMVSILIAIPSAYFATETVLFIVKSQEKIFCGQIWPVDQQLYY
KSYFLFIFGVEFVGPVVTMTLCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVL
VLMCILTAYVLCWAPFYGFTIVRDFFPTVFVKEKHYLTAFYVVECIAMSNSMINT
VCFVTVKNNTMKYFKKMMLLHWRPSQRGSKSSADLDLRTNGVPTTEEVDCIRLK

Function of PROKR2 Membrane Protein

PROKR2 is a G protein-coupled receptor and the activity of PROKR2 is activated by its ligands, prokineticins 2 (PROK2), which belong to the AVIT protein family. The most important function of PROKR2 and its ligand PROK2 signalling pathway is the regulation of the secretion of neurohormone in the mammalian reproductive system. The PROKR2 knockout mice have a failure in GnRH secretion resulting in an impairment of sexual development and fertility in both male and female mice. Kallmann syndrome associated PKR2 mutations fail to bind with its ligand and couple with G protein, resulting in the deficiency in the trafficking onto the cell membrane. The patients caring mutations in PROK2 or PROKR2 genes have both neural and neuroendocrine developmental abnormalities, suggesting that the PROK2/PROKR2 signaling pathway plays an essential role in the embryonic development of the olfactory system. Both PROKR1 and PROKR2 are involved in mediating the releasing of prokineticins in the central and peripheral systems.

PROKR2 intracellular signaling pathways Fig.1 PROKR2 intracellular signaling pathways (Traboulsi, 2015)

Application of PROKR2 Membrane Protein in Literature

  1. Nebigil C.G. Updates on Endothelial Functions of Proangiogenic Prokineticin. Hypertension. 2016, 68(5):1091. PubMed ID: 27672031

    This article summarizes the biological functions of prokineticins (PROK) and their receptors (PROKR1 and PROKR1) in endothelial function/dysfunction and discusses the possible therapeutic potential of PROKR1 or PROKR1 in treating the cardiovascular and renal diseases.

  2. Traboulsi, W., et al. Prokineticins in central and peripheral control of human reproduction. Hormone Molecular Biology and Clinical Investigation. 2015, 24(2): 73-81. PubMed ID: 26574895

    This article reviews the function of PROKR1 and PROKR1 in controlling the reproduction of prokineticins. The mutations of PROK2 and PROKR2 are involved in the development of Kallmann syndrome, which is the direct consequence of the abnormality of the reproductive system.

  3. Chen D-N., et al. Functional Rescue of Kallmann Syndrome-associated Prokineticin Receptor 2 (PKR2) Mutants Deficient in Trafficking. The Journal of Biological Chemistry. 2014, 289(22):15518-15526. PubMed ID: 24753254

    Authors in this group demonstrate that the combined treatment of the PROKR2 antagonist and glycerol can rescue the trafficking deficiency associated PROKR2 mutants, suggesting a potential treatment strategy to patients harboring trafficking-defective PROKR2 mutations.

  4. Zhou C., et al. (2014) Mild Moxibustion Decreases the Expression of Prokineticin 2 and Prokineticin Receptor 2 in the Colon and Spinal Cord of Rats with Irritable Bowel Syndrome. Evidence-based Complementary and Alternative Medicine: eCAM. 2014, 807308. PubMed ID: 25024732

    This article reports the important role of prokineticin 2 (PK2) and its receptor PROKR2 in mild moxibustion analgesia in rats with chronic visceral hyperalgesia. The results of this article prove the mild moxibustion can suppress the abnormally increased expression of PK2/PROKR2 in the colon and spinal cord of IBS model rats.

  5. Martin C., et al. The Role of the Prokineticin 2 Pathway in Human Reproduction: Evidence from the Study of Human and Murine Gene Mutations. Endocr. Rev. 2011, 32(2):225-246. PubMed ID: 21037178

    This article shows the detailed clinical studies of patients with PROK2/PROKR2 mutations, suggesting the broader biological role of the PROK2/PROKR2 pathway in humans.

PROKR2 Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-PROKR2 antibody development services.


Creative Biolabs is a global research institute as well as a leading service provider in the field of membrane protein to make the membrane protein research easier for customers around the world. We have won rich experience by successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

Reference

  1. Traboulsi, W., et al. (2015) Prokineticins in central and peripheral control of human reproduction. Hormone Molecular Biology and Clinical Investigation, 24(2): 73-81.

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

45-1 Ramsey Road, Shirley, NY 11967, USA
Call us at:
USA: 1-631-381-2994
Europe: 44-207-097-1828
Fax: 1-631-207-8356
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us