Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of PTGER1
PTGER1, also known as Prostaglandin E2 receptor 1 (EP1), is a 42 kDa prostaglandin receptor encoded by the PTGER1 gene. EP1 is one of four identified EP receptors, EP1, EP2, EP3, and EP4 which bind with and mediate cellular responses principally to (prostaglandin E2) (PGE2) and also with lesser affinity and responsiveness to other prostanoids. Animal model studies have implicated EP1 in various physiological and pathological responses. However, key differences in the distribution of EP1 between these test animals and humans as well as other complicating issues make it difficult to establish the function(s) of this receptor in human health and disease.
| Basic Information of PTGER1 | |
| Protein Name | Prostaglandin E2 receptor EP1 subtype |
| Gene Name | PTGER1 |
| Aliases | Prostaglandin E2 receptor EP1 subtype, PGE receptor EP1 subtype, PGE2 receptor EP1 subtype, Prostanoid EP1 receptor |
| Organism | Homo sapiens (Human) |
| UniProt ID | P34995 |
| Transmembrane Times | 7 |
| Length (aa) | 402 |
| Sequence |
MSPCGPLNLSLAGEATTCAAPWVPNTSAVPPSGASPALPIFSMTLGAVSNLLALALLAQA AGRLRRRRSAATFLLFVASLLATDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMVFF GLCPLLLGCGMAVERCVGVTRPLLHAARVSVARARLALAAVAAVALAVALLPLARVGRYE LQYPGTWCFIGLGPPGGWRQALLAGLFASLGLVALLAALVCNTLSGLALLRARWRRRSRR PPPASGPDSRRRWGAHGPRSASASSASSIASASTFFGGSRSSGSARRARAHDVEMVGQLV GIMVVSCICWSPMLVLVALAVGGWSSTSLQRPLFLAVRLASWNQILDPWVYILLRQAVLR QLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLSHF |
Function of PTGER1 Membrane Protein
This PTGER1 receptor is PGE2, which serves several functions. PGE2 can mediate hyperalgesia. It causes increased pain perception when administered into the central nervous system but inhibits pain perception when administered systemically. It not only promotes colon cancer development in Azoxymethane-induced and APC gene knockout mice, but also promotes hypertension in diabetic mice and spontaneously hypertensive rats. In addition, it may be differentially involved in etiology of acute brain injuries. Pharmacological inhibition or genetic deletion of EP1 receptor produce beneficial of deleterious effects in rodent models of neurological disorders, such as ischemic stroke, epileptic seizure, surgically induced brain injury and traumatic brain injury.
Application of PTGER1 Membrane Protein in Literature
This article explores the underlying mechanisms that affect the growth and function of endometrial epithelium and stroma by assessing the staining intensity of PGE2 receptors (EP) in healthy endometrium across the menstrual cycle and in pathological endometrium, such as ovarian endometriosis and endometrial cancer.
The article suggests that the anti-HCC effects of EGCG might be mediated, at least partially, through the suppressing EP(1) receptor expression and PGE(2) production.
The article carries out an association study of EP1 gene polymorphisms with suicide completers in the Japanese population. They could not find an association of EP1 gene with suicide in the Japanese population.
This article suggests that a role for EP1 in metastasis and EP1 functions as a metastasis suppressor and that loss of nuclear EP1 is associated with poorer overall survival and may contribute to disparities in outcome in different populations.
The article supports a role for the EP1 receptor in regulating keratinocyte differentiation. And the PTGER1 is expressed in the differentiated compartment of the normal human epidermis and is coupled to intracellular calcium mobilization.
PTGER1 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-PTGER1 antibody development services.
As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
