Close

PTH2R Membrane Protein Introduction

Introduction of PTH2R

PTH2R (Parathyroid hormone 2 receptor), also known as PTH2 receptor, is a protein encoded by the PTH2R gene in humans. The protein encoded by this gene is a member of the G protein-coupled receptor family 2. PTH2R is a receptor for parathyroid hormone. The molecular interaction of the PTH2 receptor with the peptide TIP39 has been characterized in full 3D molecular detail, identifying among other residues Tyr-318 in transmembrane helix 5 as a key residue for high affinity binding.

Basic Information of PTH2R
Protein Name Parathyroid hormone 2 receptor
Gene Name PTH2R
Aliases Parathyroid hormone 2 receptor, PTH2 receptor
Organism Homo sapiens (Human)
UniProt ID P49190
Transmembrane Times 7
Length (aa) 550
Sequence MAGLGASLHVWGWLMLGSCLLARAQLDSDGTITIEEQIVLVLKAKVQCELNITAQLQEGEGNCFPEWDGL
ICWPRGTVGKISAVPCPPYIYDFNHKGVAFRHCNPNGTWDFMHSLNKTWANYSDCLRFLQPDISIGKQEF
FERLYVMYTVGYSISFGSLAVAILIIGYFRRLHCTRNYIHMHLFVSFMLRATSIFVKDRVVHAHIGVKEL
ESLIMQDDPQNSIEATSVDKSQYIGCKIAVVMFIYFLATNYYWILVEGLYLHNLIFVAFFSDTKYLWGFI
LIGWGFPAAFVAAWAVARATLADARCWELSAGDIKWIYQAPILAAIGLNFILFLNTVRVLATKIWETNAV
GHDTRKQYRKLAKSTLVLVLVFGVHYIVFVCLPHSFTGLGWEIRMHCELFFNSFQGFFVSIIYCYCNGEVQ
AEVKKMWSRWNLSVDWKRTPPCGSRRCGSVLTTVTHSTSSQSQVAASTRMVLISGKAAKIASRQPDSHIT
LPGYVWSNSEQDCLPHSFHEETKEDSGRQGDDILMEKPSRPMESNPDTEGCQGETEDVL

Function of PTH2R Membrane Protein

As a receptor for parathyroid hormone (PTH), PTH2R is more selective in ligand recognition and has a more specific tissue distribution compared to parathyroid hormone 1 receptor (PTH1R). It is activated by PTH but not by parathyroid hormone-like hormone (PTHLH) and is particularly abundant in the brain and pancreas. Moreover, some studies suggested that PTH2R is involved in the regulation of viscerosensory information processing. In addition, variation in the PTH2R gene (Chr2q34, rs897083) may contribute to the age-associated degenerative manifestations that develop at the lumbar spine.

Structure of PTH2R membrane protein. Fig.1 Structure of PTH2R membrane protein.

Application of PTH2R Membrane Protein in Literature

  1. Seeliger S., et al. The parathyroid hormone-2 receptor is expressed on human leukocytes and down-regulated in hyperparathyroidism. Clin Nephrol. 2003, 59(6): 429-435. PubMed ID:12834174

    The article concludes that PTH2 receptor is expressed on human granulocytes and--to a lesser degree--on monocytes and lymphocytes. In patients with hyperparathyroidism, the PTH2 receptor is down-regulated as function of plasma PTH levels.

  2. Bagó A.G., et al. Evidence for the expression of parathyroid hormone 2 receptor in the human brainstem. Ideggyogyaszati szemle. 2008, 61(3-4): 123. PubMed ID:18459453

    The article reveals that independent demonstration of the presence of PTH2R mRNA and immunoreactivity supports the specific expression of the PTH2R in the human brainstem.

  3. Åkesson K., et al. Variation in the PTH2R gene is associated with age-related degenerative changes in the lumbar spine. J Bone Miner Metab. 2015, 33(1): 9-15. PubMed ID:24378925

    The article explores the hypothesis that polymorphisms (SNPs) within genes in this pathway (PTH, PTHLH, PTH1R and PTH2R) contribute to degenerative manifestations of the spine in elderly women. And variation in the PTH2R gene (Chr2q34, rs897083) may contribute to the age-associated degenerative manifestations that develop at the lumbar spine.

  4. Kim J., et al. Breakpoint mapping by whole genome sequencing identifies PTH2R gene disruption in a patient with midline craniosynostosis and a de novo balanced chromosomal rearrangement. J Med Genet. 2015. PubMed ID:26044810

    The article reports PTH2R as a gene that is disrupted in NSC. The disruption of the PTH2R gene may cause uncontrolled proliferation and differentiation of chondrocytes, which in turn results in premature closure of sutures.

  5. Weaver R.E., et al. High affinity binding of the peptide agonist TIP-39 to the Parathyroid hormone 2 (PTH2) receptor requires the hydroxyl group of Tyr-318 on transmembrane helix 5. Biochemical Pharmacology. 2017, 127: 71-81. PubMed ID: 28012961

    The article indicates that high affinity binding of the peptide agonist TIP-39 to the PTH2 receptor requires the hydroxyl group of Tyr-318 on transmembrane helix 5.

PTH2R Preparation Options

To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-PTH2R antibody development services.


As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.


All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us