Close

RAMP1 Membrane Protein Introduction

Introduction of RAMP1

Receptor Activity Modification Protein 1 (RAMP1) is a protein encoded by RAMP1 gene in humans. It is a member of the RAMP family, which are also known as single-transmembrane domain proteins called receptor (calcitonin) activity-modifying proteins (RAMPs). RAMP1 is a type I transmembrane protein consist of an extracellular N-terminus and a cytoplasmic C-terminus.

Basic Information of RAMP1
Protein Name Receptor activity-modifying protein 1
Gene Name RAMP1
Aliases Calcitonin-receptor-like receptor activity-modifying protein 1 (CRLR activity-modifying protein 1)
Organism Homo sapiens (Human)
UniProt ID O60894
Transmembrane Times 1
Length (aa) 148
Sequence MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILYPFIVVPITVTLLVTALVVWQSKRTEGIV

Function of RAMP1 Membrane Protein

RAMP1 is required to transport the calciton receptor-receptor (CALCRL) onto the plasma membrane. CALCRL is a receptor with seven transmembrane domains that can act as a calcitonin gene-related peptide (CGRP) receptor or adrenergic receptor, depending on how members of the slope family are expressed. In combination with RAMP proteins, CALCRL acts as a CGRP receptor. RAMPs have been shown to interact with g-protein-coupled receptors such as the calcitonin receptor, vasoactive intestinal peptide receptor (VIPR), calcitonin receptor, calcium-sensing receptor, parathyroid hormone receptor, high Glucagon receptor and corticotropin releasing factor receptor 1 to regulate their trafficking, pharmacological properties and signaling capabilities.

The structure of Receptor activity-modifying protein 1 Fig.1 The structure of Receptor activity-modifying protein 1.

Application of RAMP1 Membrane Protein in Literature

  1. Li M., et al. Deficiency of RAMP1 Attenuates Antigen-Induced Airway Hyperresponsiveness in Mice. PLoS ONE. 2014,9 (7): e102356.PubMed ID: 25010197

    This article shows that the interface of the ramp-receptor is pharmacologically treatable, suggesting that it may be possible to develop compounds directed to the RAMP1/CLR interface to aid in the treatment of asthma.

  2. Logan M., et al. RAMP1 Is a Direct NKX3.1 Target Gene Up-Regulated in Prostate Cancer That Promotes Tumorigenesis. The American Journal of Pathology. 2013,183 (3): 951–963. PubMed ID: 23867798

    These data provide new insights into the role of RAMP1 in promoting prostate tumorigenesis and support the possibility of being a new biomarker and a potential therapeutic target in prostate cancer.

  3. Wan D., et al. DNA Methylation of RAMP1 Gene in Migraine: An Exploratory Analysis. The Journal of Headache and Pain2015, (16): 90. PubMed ID: 26501962

    This study provides the first evidence that DNA methylation of RAMP1 promoters may play a role in migraine.

  4. Barbash S., et al. GPCRs Globally Coevolved with Receptor Activity-Modifying Proteins, RAMPs. Proceedings of the National Academy of Sciences of the United States of America. 2017,114 (45): 12015–12020. PubMed ID: 29078385

    These results demonstrate the co-evolution of global GPCRs and RAMPs and support the hypothesis that GPCRs interact globally with RAMPs on cellular signaling pathways.

  5. Hay D.L., Pioszak AA. RAMPs (Receptor-Activity Modifying Proteins): New Insights and Roles. Annual review of pharmacology and toxicology. 2016, (56):469-487. PubMed ID: 26514202

    This review covers recent discoveries in the field of RAMPs and summarizes the capabilities of known GPCR partners and RAMPs.

RAMP1 Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-RAMP1 antibody development services.


Creative Biolabs' skillful scientists are glad to leverage our expertise and advanced technologies to help you with the member protein research. If you are interested, please feel free to contact us for more details.

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

45-1 Ramsey Road, Shirley, NY 11967, USA
Call us at:
USA: 1-631-381-2994
Europe: 44-207-097-1828
Fax: 1-631-207-8356
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us