Receptor Activity Modification Protein 2, also known as RAMP2, is a protein that is encoded by RAMP2 gene in humans. The protein is a member of the slope family of single-transmembrane domain proteins called receptor (calcitonin) activity-modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with extracellular n-terminus and cytoplasmic c-terminus. RAMPs are required to transport the calcitonin-receptor (CRLR) receptor (CRLR) onto the plasma membrane. CRLR is a receptor with seven transmembrane domains that can act as a calcitonin gene-related peptide (CGRP) receptor or adrenergic receptor, depending on how members of the slope family are expressed. In the presence of this (RAMP2) protein, CRLR acts as an adrenergic receptor. This RAMP2 protein is involved in the transport of core glycosylation and adrenergic receptors on the cell surface.
| Basic Information of RAMP2 | |
| Protein Name | Receptor activity-modifying protein 2 |
| Gene Name | RAMP2 |
| Aliases | Calcitonin-receptor-like receptor activity-modifying protein 2 (CRLR activity-modifying protein 2) |
| Organism | Homo sapiens (Human) |
| UniProt ID | O60895 |
| Transmembrane Times | 1 |
| Length (aa) | 175 |
| Sequence | MASLRVERAGGPRLPRTRVGRPAALRLLLLLGAVLNPHEALAQPLPTTGTPGSEGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQPTFSDPPEDVLLAMIIAPICLIPFLITLVVWRSKDSEAQA |
As the second RAMPs of three mammalian RAMPs, RAMP2 is characterized primarily by its association with the calcitonin receptor (Calcrl, CLR) as a standard receptor for the endocrine peptide adrenaline (Adm, AM). Importantly, RAMP2 also binds to other family B GPCRs: Calcium Receptor (Ctr), Corticotropin Releasing Hormone Receptor 1 (Crhr1), Glucagon Receptor (Gcgr), Parathyroid Hormone Receptor 1 (Pth1r), as well as vasoactive intestinal polypeptide receptors 1 and 2 (Vpac1r and Vpac2r). These three RAMPs (RAMP1, RAMP2, and RAMP3) were first recognized as important components of the calcitonin gene-related peptide (CGRP) and adrenaline (AM) receptors. In addition to this interaction with calcitonin-like-related receptors (CLRs), they need to promote trafficking to the cell surface, and RAMPs are also associated with other family B GPCRs, including calcitonin receptor-regulating ligands and G-protein selection, Vasoactive intestinal polypeptide/pituitary AC-activating peptide 1 (VPAC1) receptor, and GCGR
Fig.1 The structure of Receptor activity-modifying protein 2.
This study suggests that the behavior of RAMP2 may alter the agonist activity and trafficking in GCGR and may be potentially correlated with the production of new peptide analogs.
These results indicate that the AM-RAMP2 system inhibits tubular cell death caused by ER stress and thus protects the kidney.
This article revealed a previously unrecognized target of the high glucose receptor as a GLP-1 receptor agonist and highlighted the role of the RAMP2 in regulating its pharmacology.
These studies provide in vivo evidence demonstrating that the RAMP2-CLR/AM signaling pattern is different from RAMP2 during placental development and identifies additional pathways for endocrine and reproductive defects in adult females of the previously characterized RAMP2.
This is the first research to study the relationship between ADM receptor genes (RAMP2 and CLR) and stroke based on human genetic-environment interactions.
To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-RAMP2 antibody development services.
Creative Biolabs' skillful scientists are glad to leverage our expertise and advanced technologies to help you with the member protein research. If you are interested, please feel free to contact us for more details.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.