Close

S1PR3 Membrane Protein Introduction

Introduction of S1PR3

Sphingosine 1-phosphate receptor 2 (S1PR3), also known as S1P3 or S1P receptor 3, is encoded by the S1PR3 gene. It belongs to the G-protein-coupled receptor (GPCR) family which has been extensively studied during the past few decades because it offers numerous possibilities for therapeutic applications. S1PR3 is expressed in all tissues, but most abundantly in heart, placenta, kidney, and liver.

Basic Information of S1PR3
Protein Name Sphingosine 1-phosphate receptor 2
Gene Name S1PR3
Aliases S1P receptor 3, S1P3, EDG3
Organism Homo sapiens (Human)
UniProt ID Q99500
Transmembrane Times 7
Length (aa) 378
Sequence MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMVLIAIWKNNK
FHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFVALGASTCSLLAIAIERHL
TMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLHNLPDCSTILPLYSKKYIAFCISIFTAI
LVTIVILYARIYFLVKSSSRKVANHNNSERSMALLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPI
LFKAQWFIVLAVLNSAMNPVIYTLASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNS
SHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN

Function of S1PR3 Membrane Protein

S1PR3 is a receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. Cell culture and mouse researches revealed that S1PR3 agonists may help treat wound healing. Besides, in human umbilical vein endothelial cells, compared with no treatment, the S1PR1 and S1PR3 agonist Gilenya fingolimod promoted the secretion of proregenerative cytokines. What’s more, a study has reported that phosphorylation of the S1P receptor S1PR3 is improved specifically in response to S1P. Truncation of the receptor's carboxyl-terminal domain suggested that the presence of a serine-rich stretch of residues between Leu332 and Val352 was essential to observe this effect.

A working model for the functions of SphK/S1P/S1PR3 in CSC regulation. Fig.1 A working model for the functions of SphK/S1P/S1PR3 in CSC regulation.

Application of S1PR3 Membrane Protein in Literature

  1. An s., et al. Sphingosine 1-phosphate-induced cell proliferation, survival, and related signaling events mediated by G protein-coupled receptors Edg3 and Edg5. Biol Chem. 2000, 275(1): 288-96. PubMed ID: 10617617

    This article indicates that Edg3 and Edg5 mediated the serum response element activation through transcriptional factors Elk-1 and serum response factor. Thus, specific G protein-coupled receptors Edg3 and Edg5 account for, at least in part, S1P-induced cell proliferation, survival, and related signaling events.

  2. Himmel H.M., et al. Evidence for Edg-3 receptor-mediated activation of I(K.ACh) by sphingosine-1-phosphate in human atrial cardiomyocytes. Mol Pharmacol. 2000, 58(2): 449-54. PubMed ID: 10908314

    This article suggests that SPP-induced I (K.ACh) activation in human atrial myocytes is mediated by the S1PR3 subtype of SPP receptors.

  3. Windh R.T., et al. Differential coupling of the sphingosine 1-phosphate receptors Edg-1, Edg-3, and H218/Edg-5 to the G(i), G(q), and G(12) families of heterotrimeric G proteins. Biol Chem. 1999, 274(39): 27351-8. PubMed ID: 10488065

    This article represents the first characterization of S1P receptor activity through G proteins directly and establishes fundamental differences in coupling.

  4. Ruthford C., et al. Phosphorylation-independent internalisation and desensitisation of the human sphingosine-1-phosphate receptor S1P3. Cell Signal. 2005, 17(8): 997-1009. PubMed ID: 15894172

    This article reveals that S1PR3 function is not subject to conventional regulation by GRK phosphorylation and that novel aspect of S1PR3 function distinct from classical G-protein coupling and receptor internalisation may be controlled its carboxyl-terminal domain.

  5. Fiber C.B., et al. Modulation of total Akt kinase by increased expression of a single isoform: requirement of the sphingosine-1-phosphate receptor, Edg3/S1P3, for the VEGF-dependent expression of Akt3 in primary endothelial cells. Exp Cell Res. 2006, 312(7): 1164-73. PubMed ID: 16527273

    This article shows that VEGF stimulation requires Gi-protein signaling. They show that the VEGF stimulates the expression of S1PR3 and that expression of this Gi-protein-coupled receptor is both sufficient and necessary for the expression of Akt3.

S1PR3 Preparation Options

To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-S1PR3 antibody development services.


As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.


All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us